BLASTX nr result
ID: Rehmannia28_contig00003927
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003927 (611 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012568395.1| PREDICTED: U3 small nucleolar RNA-associated... 54 2e-06 >ref|XP_012568395.1| PREDICTED: U3 small nucleolar RNA-associated protein 25-like [Cicer arietinum] Length = 103 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = -1 Query: 110 QPIEPNGSLFASYIGFIARENISITINNWRNKELR 6 QPI+PN S+F SYIG + R+NI ITI++WRNK L+ Sbjct: 43 QPIDPNNSMFVSYIGAVVRQNIPITIDDWRNKALK 77