BLASTX nr result
ID: Rehmannia28_contig00003873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003873 (570 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015088447.1| PREDICTED: chlorophyll synthase, chloroplast... 89 7e-18 ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplast... 89 7e-18 ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplast... 89 7e-18 ref|XP_009762729.1| PREDICTED: chlorophyll synthase, chloroplast... 89 7e-18 ref|XP_009606938.1| PREDICTED: chlorophyll synthase, chloroplast... 89 7e-18 gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] 89 7e-18 gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum] 89 7e-18 ref|XP_012832194.1| PREDICTED: chlorophyll synthase, chloroplast... 89 8e-18 gb|EYU41923.1| hypothetical protein MIMGU_mgv1a007461mg [Erythra... 89 9e-18 gb|EYU41922.1| hypothetical protein MIMGU_mgv1a007461mg [Erythra... 89 9e-18 ref|XP_009376427.1| PREDICTED: chlorophyll synthase, chloroplast... 89 1e-17 ref|XP_008362316.1| PREDICTED: chlorophyll synthase, chloroplast... 89 1e-17 ref|XP_009376426.1| PREDICTED: chlorophyll synthase, chloroplast... 89 1e-17 ref|XP_008362312.1| PREDICTED: chlorophyll synthase, chloroplast... 89 1e-17 ref|XP_013449185.1| bacteriochlorophyll synthase, putative [Medi... 89 1e-17 ref|XP_013449186.1| bacteriochlorophyll synthase, putative [Medi... 89 1e-17 gb|KRH07608.1| hypothetical protein GLYMA_16G098000 [Glycine max] 85 1e-17 ref|XP_004302558.1| PREDICTED: chlorophyll synthase, chloroplast... 88 2e-17 ref|XP_011095035.1| PREDICTED: chlorophyll synthase, chloroplast... 88 3e-17 ref|XP_015897235.1| PREDICTED: chlorophyll synthase, chloroplast... 88 3e-17 >ref|XP_015088447.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum pennellii] Length = 369 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 327 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum tuberosum] Length = 369 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 327 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum lycopersicum] Length = 369 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 327 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_009762729.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana sylvestris] Length = 373 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_009606938.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana tomentosiformis] Length = 373 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 89.4 bits (220), Expect = 7e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_012832194.1| PREDICTED: chlorophyll synthase, chloroplastic [Erythranthe guttata] Length = 376 Score = 89.4 bits (220), Expect = 8e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 334 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 376 >gb|EYU41923.1| hypothetical protein MIMGU_mgv1a007461mg [Erythranthe guttata] Length = 404 Score = 89.4 bits (220), Expect = 9e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 362 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 404 >gb|EYU41922.1| hypothetical protein MIMGU_mgv1a007461mg [Erythranthe guttata] Length = 406 Score = 89.4 bits (220), Expect = 9e-18 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 364 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 406 >ref|XP_009376427.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 373 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 373 >ref|XP_008362316.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 [Malus domestica] Length = 373 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 331 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 373 >ref|XP_009376426.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 374 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 332 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 374 >ref|XP_008362312.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 [Malus domestica] Length = 374 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 332 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 374 >ref|XP_013449185.1| bacteriochlorophyll synthase, putative [Medicago truncatula] gi|657378438|gb|KEH23212.1| bacteriochlorophyll synthase, putative [Medicago truncatula] Length = 377 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 335 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 377 >ref|XP_013449186.1| bacteriochlorophyll synthase, putative [Medicago truncatula] gi|657378439|gb|KEH23213.1| bacteriochlorophyll synthase, putative [Medicago truncatula] Length = 378 Score = 89.0 bits (219), Expect = 1e-17 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 336 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 378 >gb|KRH07608.1| hypothetical protein GLYMA_16G098000 [Glycine max] Length = 169 Score = 85.1 bits (209), Expect = 1e-17 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 565 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 PQVFFQFKYF KDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 128 PQVFFQFKYFRKDPVKYDVKYQASAQPFLVLGLLVTALATSH 169 >ref|XP_004302558.1| PREDICTED: chlorophyll synthase, chloroplastic [Fragaria vesca subsp. vesca] Length = 374 Score = 88.2 bits (217), Expect = 2e-17 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -3 Query: 568 APQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 APQVFFQFKYFLKDPVKYDVKYQASAQPFL+LG+LVTALATSH Sbjct: 332 APQVFFQFKYFLKDPVKYDVKYQASAQPFLVLGILVTALATSH 374 >ref|XP_011095035.1| PREDICTED: chlorophyll synthase, chloroplastic [Sesamum indicum] Length = 373 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 565 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 332 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_015897235.1| PREDICTED: chlorophyll synthase, chloroplastic [Ziziphus jujuba] Length = 374 Score = 87.8 bits (216), Expect = 3e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 565 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 440 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 333 PQVFFQFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374