BLASTX nr result
ID: Rehmannia28_contig00003842
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00003842 (1002 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836354.1| PREDICTED: prostatic spermine-binding protei... 58 1e-06 >ref|XP_012836354.1| PREDICTED: prostatic spermine-binding protein-like [Erythranthe guttata] Length = 175 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = +3 Query: 264 MEVTKFSSDMSALRKQLVLCSFVEAAAVSTLLAAHKSLACLLMTTGSLLN 413 MEV K S DM+ L KQL++ SF+EAAAV+T+ AAHK+L LLM ++LN Sbjct: 1 MEVNKLSPDMAVLSKQLMVSSFLEAAAVNTVFAAHKTLVSLLMLAEAMLN 50