BLASTX nr result
ID: Rehmannia28_contig00002316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00002316 (403 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP02457.1| unnamed protein product [Coffea canephora] 56 1e-06 sp|Q8VWZ7.1|C76B6_CATRO RecName: Full=Geraniol 8-hydroxylase; Al... 55 2e-06 ref|XP_011099226.1| PREDICTED: geraniol 8-hydroxylase-like [Sesa... 55 2e-06 gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor] 54 5e-06 gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia s... 54 5e-06 gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hub... 54 6e-06 gb|AGX93051.1| geraniol 10-hydroxylase-like protein [Cinchona ca... 54 6e-06 ref|XP_015170228.1| PREDICTED: geraniol 8-hydroxylase-like [Sola... 53 6e-06 gb|ADX99241.1| geraniol 10-hydroxylase [Picrorhiza kurrooa] 54 8e-06 >emb|CDP02457.1| unnamed protein product [Coffea canephora] Length = 269 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 GI PKDLDMEEKFGITLQKA PLRAVP+ L Sbjct: 240 GIAPKDLDMEEKFGITLQKALPLRAVPINL 269 >sp|Q8VWZ7.1|C76B6_CATRO RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome P450 76B6; AltName: Full=Geraniol 10-hydroxylase; Short=CrG10H gi|17065916|emb|CAC80883.1| geraniol 10-hydroxylase [Catharanthus roseus] gi|558613871|gb|AHA82034.1| geraniol 10-hydroxylase [Catharanthus roseus] gi|758422066|gb|AJO70761.1| geraniol-8-hydroxylase [synthetic construct] Length = 493 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 G+ PKDLDMEEKFGITLQKA PLRAVP TL Sbjct: 464 GMAPKDLDMEEKFGITLQKAHPLRAVPSTL 493 >ref|XP_011099226.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum] Length = 494 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 GIGPK+LDM+EKFGITLQKA+PLRAVP+ L Sbjct: 465 GIGPKELDMDEKFGITLQKARPLRAVPLPL 494 >gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor] Length = 493 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 GI PKDLDMEEKFGITLQKA PLRAVP L Sbjct: 464 GIAPKDLDMEEKFGITLQKAHPLRAVPSPL 493 >gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina] Length = 493 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPV 319 GI PKDLDMEEKFGITLQKA PLRAVP+ Sbjct: 464 GITPKDLDMEEKFGITLQKAHPLRAVPI 491 >gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii] Length = 493 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVP 322 GI PKDLDMEEKFGITLQKA PLRAVP Sbjct: 464 GIAPKDLDMEEKFGITLQKAHPLRAVP 490 >gb|AGX93051.1| geraniol 10-hydroxylase-like protein [Cinchona calisaya] Length = 493 Score = 53.9 bits (128), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 GI PK LDMEEKFGITLQKA PLRAVP++L Sbjct: 464 GIAPKGLDMEEKFGITLQKAYPLRAVPISL 493 >ref|XP_015170228.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum] Length = 184 Score = 52.8 bits (125), Expect = 6e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 GI PKDLDMEEKFGITL KAQPL A+P+ L Sbjct: 155 GIAPKDLDMEEKFGITLAKAQPLLAIPIPL 184 >gb|ADX99241.1| geraniol 10-hydroxylase [Picrorhiza kurrooa] Length = 489 Score = 53.5 bits (127), Expect = 8e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 402 GIGPKDLDMEEKFGITLQKAQPLRAVPVTL 313 G GPKDLDMEEKFGITLQKA PL AVP+ L Sbjct: 460 GAGPKDLDMEEKFGITLQKALPLMAVPIPL 489