BLASTX nr result
ID: Rehmannia28_contig00002056
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00002056 (510 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088833.1| PREDICTED: pentatricopeptide repeat-containi... 75 6e-13 ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 70 3e-11 ref|XP_015085097.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_010325168.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_009604488.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_011088833.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] Length = 625 Score = 75.5 bits (184), Expect = 6e-13 Identities = 38/69 (55%), Positives = 49/69 (71%) Frame = -3 Query: 208 MGYQEEFHKEMSNLEINSKNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCT 29 MGY EEF K+ SN +I SK+ ++ ++ +ER +E S EKIQ YP+PESTLCTFC Sbjct: 1 MGYLEEFDKDSSNSKIKSKSQASTLVLNER------QETSHGEKIQVYPIPESTLCTFCM 54 Query: 28 SKESCKIVR 2 + ESCKIVR Sbjct: 55 NGESCKIVR 63 >ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g25630 [Erythranthe guttata] Length = 571 Score = 70.5 bits (171), Expect = 3e-11 Identities = 39/69 (56%), Positives = 43/69 (62%) Frame = -3 Query: 208 MGYQEEFHKEMSNLEINSKNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCT 29 MGY EEF KE +N EIN KN Q+ I ++S DEKI F P ES LCTFCT Sbjct: 1 MGYLEEFDKESANSEINCKN-----------QDDPIMKRSPDEKINFNPPSESPLCTFCT 49 Query: 28 SKESCKIVR 2 S ESCKIVR Sbjct: 50 SDESCKIVR 58 >ref|XP_015085097.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X1 [Solanum pennellii] Length = 647 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = -3 Query: 202 YQEEFHKEMSNLEINSKNDSNL--VLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCT 29 Y ++F KE SN E NS+ S + ++R E + SIKEK ++K+ P PES+LC FC Sbjct: 18 YMDDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCV 76 Query: 28 SKESCKIVR 2 + SC+ VR Sbjct: 77 NGNSCRTVR 85 >ref|XP_010325168.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Solanum lycopersicum] Length = 675 Score = 59.3 bits (142), Expect = 2e-07 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%) Frame = -3 Query: 202 YQEEFHKEMSNLEINSKNDSNL--VLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCT 29 Y ++F KE SN E NS+ S + ++R E + SIKEK ++K+ P PES+LC FC Sbjct: 46 YMDDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCV 104 Query: 28 SKESCKIVR 2 + SC+ VR Sbjct: 105 NGNSCRTVR 113 >ref|XP_006356647.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] gi|565380524|ref|XP_006356648.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Solanum tuberosum] Length = 629 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/66 (42%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -3 Query: 196 EEFHKEMSNLEINS-KNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCTSKE 20 ++F KE SN E + K+ ++R E + SIKEK D+K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCEKSRRKSGMKTLIRKELLHPFSIKEKDLDDKMPLQPTPESSLCAFCVNGN 61 Query: 19 SCKIVR 2 SC+ VR Sbjct: 62 SCRTVR 67 >ref|XP_015085098.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like isoform X2 [Solanum pennellii] Length = 629 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = -3 Query: 196 EEFHKEMSNLEINSKNDSNL--VLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCTSK 23 ++F KE SN E NS+ S + ++R E + SIKEK ++K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCVNG 60 Query: 22 ESCKIVR 2 SC+ VR Sbjct: 61 NSCRTVR 67 >ref|XP_004245260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Solanum lycopersicum] Length = 629 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 2/67 (2%) Frame = -3 Query: 196 EEFHKEMSNLEINSKNDSNL--VLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCTSK 23 ++F KE SN E NS+ S + ++R E + SIKEK ++K+ P PES+LC FC + Sbjct: 2 DDFRKERSNCE-NSRRKSGMKTLIRKEFLHPFSIKEKDLEDKMPLRPTPESSLCAFCVNG 60 Query: 22 ESCKIVR 2 SC+ VR Sbjct: 61 NSCRTVR 67 >ref|XP_009604488.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Nicotiana tomentosiformis] Length = 640 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/68 (41%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = -3 Query: 202 YQEEFHKEMSNLEI-NSKNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCTS 26 Y ++F KE N E + K+ ++R E + IKEK D+K+ P PES LCTFC + Sbjct: 11 YMDDFGKEKRNCETYHKKSGMRTLIRKEWLHTSPIKEKDLDDKMPLRPTPESVLCTFCVN 70 Query: 25 KESCKIVR 2 SC+ VR Sbjct: 71 GNSCRTVR 78