BLASTX nr result
ID: Rehmannia28_contig00001969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00001969 (320 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099291.1| PREDICTED: zinc finger CCHC domain-containin... 76 4e-14 ref|XP_012852462.1| PREDICTED: zinc finger CCHC domain-containin... 70 4e-12 gb|EYU44297.1| hypothetical protein MIMGU_mgv1a004282mg [Erythra... 69 2e-11 ref|XP_009784992.1| PREDICTED: zinc finger CCHC domain-containin... 67 5e-11 ref|XP_009617260.1| PREDICTED: uncharacterized protein LOC104109... 65 4e-10 ref|XP_010247125.1| PREDICTED: uncharacterized protein LOC104590... 59 3e-08 ref|XP_015071239.1| PREDICTED: uncharacterized protein LOC107015... 57 2e-07 ref|XP_012462826.1| PREDICTED: uncharacterized protein LOC105782... 53 5e-06 ref|XP_012462823.1| PREDICTED: zinc finger CCHC domain-containin... 53 5e-06 ref|XP_006346854.1| PREDICTED: uncharacterized protein LOC102582... 52 9e-06 >ref|XP_011099291.1| PREDICTED: zinc finger CCHC domain-containing protein 8 [Sesamum indicum] Length = 565 Score = 76.3 bits (186), Expect = 4e-14 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHD--GSPSHGQYGNFSSSSPR 154 Y+S ++S SP+ S SIPWSP+ GRSFSDRGR+SPLV D GS ++G YG F SSPR Sbjct: 509 YDSSHHSQSPQTSQSIPWSPSIGRSFSDRGRKSPLVQDRYGSSNYGHYGTFPYSSPR 565 >ref|XP_012852462.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like [Erythranthe guttata] Length = 528 Score = 70.5 bits (171), Expect = 4e-12 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSSSPR 154 ++S YYS SPR PSIPWSPTY RS SDR RRSP +GQYGN SSPR Sbjct: 480 HDSSYYSRSPRVDPSIPWSPTYARSLSDRSRRSP------SRYGQYGNLPYSSPR 528 >gb|EYU44297.1| hypothetical protein MIMGU_mgv1a004282mg [Erythranthe guttata] Length = 535 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/54 (61%), Positives = 36/54 (66%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSSSP 157 ++S YYS SPR PSIPWSPTY RS SDR RRSP +GQYGN SSP Sbjct: 478 HDSSYYSRSPRVDPSIPWSPTYARSLSDRSRRSP------SRYGQYGNLPYSSP 525 >ref|XP_009784992.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like [Nicotiana sylvestris] Length = 279 Score = 66.6 bits (161), Expect = 5e-11 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSS 163 Y+S Y S+SPR S S+P SP++GRS SDRGRRSPLV+DGS +H +G + +S Sbjct: 226 YDSHYSSISPRDSASMPRSPSFGRSLSDRGRRSPLVNDGSTNHSFHGLYYTS 277 >ref|XP_009617260.1| PREDICTED: uncharacterized protein LOC104109615 [Nicotiana tomentosiformis] Length = 535 Score = 64.7 bits (156), Expect = 4e-10 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSS 163 Y+S Y S+SPR S S+P SP++GRS SDRGRRSPLV+DG+ +H +G + +S Sbjct: 482 YDSHYSSISPRDSASMPRSPSFGRSSSDRGRRSPLVNDGTTNHSFHGLYYTS 533 >ref|XP_010247125.1| PREDICTED: uncharacterized protein LOC104590246 [Nelumbo nucifera] Length = 594 Score = 59.3 bits (142), Expect = 3e-08 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = -3 Query: 300 SLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSSSP 157 S SPR++ +P SP+ GR SDRGRRSPLVHDGSP Y + S SP Sbjct: 499 SHSPRSNIPVPRSPSLGRPLSDRGRRSPLVHDGSPGQSPYSSVSYPSP 546 >ref|XP_015071239.1| PREDICTED: uncharacterized protein LOC107015471 [Solanum pennellii] Length = 530 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGN 175 Y+S Y S SPR S S+P SP++GRS S+R RR+P+V DGS H YG+ Sbjct: 481 YDSRYSSHSPRDSASMPRSPSFGRSLSERERRNPIVKDGSYHHSFYGS 528 >ref|XP_012462826.1| PREDICTED: uncharacterized protein LOC105782557 isoform X2 [Gossypium raimondii] Length = 585 Score = 53.1 bits (126), Expect = 5e-06 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSSSPR 154 Y+S Y SPR P SPT GRS+ +RGRRSPLV++ SHG YG S SPR Sbjct: 501 YDSPYGFNSPRHPIPRPRSPTSGRSYYERGRRSPLVYEDFGSHGSYG--SRYSPR 553 >ref|XP_012462823.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like isoform X1 [Gossypium raimondii] gi|823260207|ref|XP_012462824.1| PREDICTED: zinc finger CCHC domain-containing protein 8-like isoform X1 [Gossypium raimondii] gi|763815456|gb|KJB82308.1| hypothetical protein B456_013G188400 [Gossypium raimondii] gi|763815457|gb|KJB82309.1| hypothetical protein B456_013G188400 [Gossypium raimondii] Length = 587 Score = 53.1 bits (126), Expect = 5e-06 Identities = 30/55 (54%), Positives = 35/55 (63%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGNFSSSSPR 154 Y+S Y SPR P SPT GRS+ +RGRRSPLV++ SHG YG S SPR Sbjct: 503 YDSPYGFNSPRHPIPRPRSPTSGRSYYERGRRSPLVYEDFGSHGSYG--SRYSPR 555 >ref|XP_006346854.1| PREDICTED: uncharacterized protein LOC102582187 [Solanum tuberosum] Length = 530 Score = 52.4 bits (124), Expect = 9e-06 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = -3 Query: 318 YESGYYSLSPRASPSIPWSPTYGRSFSDRGRRSPLVHDGSPSHGQYGN 175 Y+S Y S SPR S S+ SP+ GRS S+R RR+P++ DGS H YG+ Sbjct: 481 YDSRYSSHSPRDSASMSRSPSLGRSLSERDRRNPIIKDGSYHHSFYGS 528