BLASTX nr result
ID: Rehmannia28_contig00001610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00001610 (341 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38886.3| unnamed protein product [Vitis vinifera] 53 2e-06 >emb|CBI38886.3| unnamed protein product [Vitis vinifera] Length = 168 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 329 EKGQGSAMDMARRKRVRQTSEREVGIFDMI 240 EKG GSA DMARRKRVRQTSEREVG+ DM+ Sbjct: 83 EKGHGSATDMARRKRVRQTSEREVGMLDML 112