BLASTX nr result
ID: Rehmannia28_contig00000825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00000825 (373 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW44354.1| hypothetical protein EUGRSUZ_L021752, partial [Eu... 125 4e-33 ref|XP_010450398.1| PREDICTED: glutamine synthetase, chloroplast... 121 1e-32 ref|XP_010041423.1| PREDICTED: glutamine synthetase leaf isozyme... 125 2e-32 gb|AIR07818.1| chloroplastic glutamine synthetase GS2, partial [... 123 3e-32 gb|KOM53484.1| hypothetical protein LR48_Vigan09g214300 [Vigna a... 126 3e-32 ref|NP_001304236.1| glutamine synthetase leaf isozyme, chloropla... 126 3e-32 ref|XP_012069490.1| PREDICTED: glutamine synthetase leaf isozyme... 126 3e-32 ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme... 125 5e-32 ref|XP_013715117.1| PREDICTED: glutamine synthetase, chloroplast... 125 6e-32 ref|NP_001302944.1| glutamine synthetase, chloroplastic [Brassic... 125 6e-32 emb|CAB72423.1| glutamine synthetase [Brassica napus] 125 6e-32 ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplast... 125 6e-32 gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa s... 125 6e-32 ref|NP_001303068.1| glutamine synthetase, chloroplastic-like pre... 125 6e-32 ref|XP_013686781.1| PREDICTED: glutamine synthetase, chloroplast... 125 6e-32 ref|XP_013637127.1| PREDICTED: glutamine synthetase, chloroplast... 125 6e-32 ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme... 125 6e-32 ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme... 125 6e-32 ref|XP_002516801.1| PREDICTED: glutamine synthetase leaf isozyme... 125 6e-32 emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera] 125 6e-32 >gb|KCW44354.1| hypothetical protein EUGRSUZ_L021752, partial [Eucalyptus grandis] Length = 274 Score = 125 bits (314), Expect = 4e-33 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 212 NRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 271 Query: 182 LKV 190 LKV Sbjct: 272 LKV 274 >ref|XP_010450398.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like [Camelina sativa] gi|62319277|dbj|BAD94507.1| glutamate-ammonia ligase precursor [Arabidopsis thaliana] Length = 179 Score = 121 bits (303), Expect = 1e-32 Identities = 59/63 (93%), Positives = 60/63 (95%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTE GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 117 NRGCSIRVGRDTEAKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 176 Query: 182 LKV 190 L V Sbjct: 177 LNV 179 >ref|XP_010041423.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform X2 [Eucalyptus grandis] Length = 369 Score = 125 bits (314), Expect = 2e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 307 NRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 366 Query: 182 LKV 190 LKV Sbjct: 367 LKV 369 >gb|AIR07818.1| chloroplastic glutamine synthetase GS2, partial [Vitis labrusca x Vitis vinifera] Length = 273 Score = 123 bits (308), Expect = 3e-32 Identities = 58/63 (92%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCS+RVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETT+LWEPTLEAEALAAQKL+ Sbjct: 211 NRGCSVRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTILWEPTLEAEALAAQKLA 270 Query: 182 LKV 190 LKV Sbjct: 271 LKV 273 >gb|KOM53484.1| hypothetical protein LR48_Vigan09g214300 [Vigna angularis] gi|965600223|dbj|BAT87401.1| hypothetical protein VIGAN_05076400 [Vigna angularis var. angularis] Length = 429 Score = 126 bits (316), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 367 NRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 426 Query: 182 LKV 190 LKV Sbjct: 427 LKV 429 >ref|NP_001304236.1| glutamine synthetase leaf isozyme, chloroplastic [Vigna radiata] gi|951043491|ref|XP_014518375.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vigna radiata var. radiata] gi|300678122|gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata] Length = 429 Score = 126 bits (316), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 367 NRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 426 Query: 182 LKV 190 LKV Sbjct: 427 LKV 429 >ref|XP_012069490.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Jatropha curcas] gi|802579153|ref|XP_012069491.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Jatropha curcas] gi|643733136|gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas] Length = 432 Score = 126 bits (316), Expect = 3e-32 Identities = 62/63 (98%), Positives = 63/63 (100%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 370 NRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 429 Query: 182 LKV 190 LKV Sbjct: 430 LKV 432 >ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis sativus] gi|778678626|ref|XP_011651002.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis sativus] gi|700201903|gb|KGN57036.1| Glutamine synthetase [Cucumis sativus] Length = 432 Score = 125 bits (315), Expect = 5e-32 Identities = 62/63 (98%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 370 NRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 429 Query: 182 LKV 190 LKV Sbjct: 430 LKV 432 >ref|XP_013715117.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica napus] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >ref|NP_001302944.1| glutamine synthetase, chloroplastic [Brassica napus] gi|685384115|ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa] gi|12643761|sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; Flags: Precursor gi|296223|emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus] gi|674959083|emb|CDX74644.1| BnaA04g07450D [Brassica napus] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >emb|CAB72423.1| glutamine synthetase [Brassica napus] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica rapa] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >ref|NP_001303068.1| glutamine synthetase, chloroplastic-like precursor [Brassica napus] gi|1934754|emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus] Length = 428 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 366 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 425 Query: 182 LKV 190 LKV Sbjct: 426 LKV 428 >ref|XP_013686781.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica napus] Length = 429 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 367 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 426 Query: 182 LKV 190 LKV Sbjct: 427 LKV 429 >ref|XP_013637127.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica oleracea var. oleracea] Length = 429 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 367 NRGCSIRVGRDTEKKGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 426 Query: 182 LKV 190 LKV Sbjct: 427 LKV 429 >ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform X1 [Eucalyptus grandis] Length = 432 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 370 NRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 429 Query: 182 LKV 190 LKV Sbjct: 430 LKV 432 >ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like isoform X2 [Eucalyptus grandis] gi|702262027|ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like isoform X2 [Eucalyptus grandis] gi|629119831|gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis] Length = 432 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 62/63 (98%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK GKGYLEDRRPASNMDPY+VTSLLAETTLLWEPTLEAEALAAQKLS Sbjct: 370 NRGCSIRVGRDTEKQGKGYLEDRRPASNMDPYIVTSLLAETTLLWEPTLEAEALAAQKLS 429 Query: 182 LKV 190 LKV Sbjct: 430 LKV 432 >ref|XP_002516801.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Ricinus communis] gi|1000971495|ref|XP_015573327.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Ricinus communis] gi|1000971498|ref|XP_015573328.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Ricinus communis] gi|223543889|gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis] Length = 432 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTSLLAETT+LWEPTLEAEALAAQKLS Sbjct: 370 NRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLS 429 Query: 182 LKV 190 LKV Sbjct: 430 LKV 432 >emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera] Length = 433 Score = 125 bits (314), Expect = 6e-32 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +2 Query: 2 NRGCSIRVGRDTEKSGKGYLEDRRPASNMDPYVVTSLLAETTLLWEPTLEAEALAAQKLS 181 NRGCSIRVGRDTEK+GKGYLEDRRPASNMDPYVVTSLLAETT+LWEPTLEAEALAAQKLS Sbjct: 371 NRGCSIRVGRDTEKNGKGYLEDRRPASNMDPYVVTSLLAETTILWEPTLEAEALAAQKLS 430 Query: 182 LKV 190 LKV Sbjct: 431 LKV 433