BLASTX nr result
ID: Rehmannia27_contig00057490
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00057490 (370 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_035165210.1| hypothetical protein [Lactobacillus delbruec... 50 9e-06 ref|WP_035165101.1| hypothetical protein [Lactobacillus delbruec... 50 9e-06 >ref|WP_035165210.1| hypothetical protein [Lactobacillus delbrueckii] Length = 103 Score = 50.4 bits (119), Expect = 9e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 359 RQVRNLPTDRLRVPRQC*SSAGKSGPKAKPRGEVDGQPVNILVL 228 RQVR L RLR P S+ GKSGPKA+PRG VDGQ V I VL Sbjct: 20 RQVRILSAARLRFPGAGSSAQGKSGPKARPRGVVDGQQVEIPVL 63 >ref|WP_035165101.1| hypothetical protein [Lactobacillus delbrueckii] Length = 103 Score = 50.4 bits (119), Expect = 9e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -3 Query: 359 RQVRNLPTDRLRVPRQC*SSAGKSGPKAKPRGEVDGQPVNILVL 228 RQVR L RLR P S+ GKSGPKA+PRG VDGQ V I VL Sbjct: 20 RQVRILSAARLRFPGAGSSAQGKSGPKARPRGVVDGQQVEIPVL 63