BLASTX nr result
ID: Rehmannia27_contig00057300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00057300 (425 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003141992.1| hypothetical protein LOAG_06408 [Loa loa] 58 2e-08 gb|KYN05510.1| hypothetical protein ALC62_03547 [Cyphomyrmex cos... 55 1e-06 ref|XP_004990473.1| hypothetical protein PTSG_08682 [Salpingoeca... 55 5e-06 ref|XP_001894123.1| T-cell receptor beta chain ANA 11 [Brugia ma... 52 7e-06 >ref|XP_003141992.1| hypothetical protein LOAG_06408 [Loa loa] Length = 100 Score = 57.8 bits (138), Expect = 2e-08 Identities = 35/91 (38%), Positives = 47/91 (51%) Frame = +2 Query: 32 TFRNNILSNSHSQPLA*TSISVGCPVSFPRSDHRRHFRQPLRHLFQLSSPHTNTHSTHAH 211 TF N+ SN H+ P++ T + P+ P H+ +RH + HT+TH H H Sbjct: 15 TFTNSTASNQHTHPISHTKLPY--PILTPNEFHKDD-AHAVRH-----NTHTHTH-IHTH 65 Query: 212 QIT*THTPCYTDTHSELCTHTHTLIHYCTHI 304 T THT +T TH+ THTHT H THI Sbjct: 66 TDTHTHTYMHTHTHARTHTHTHTHTHTYTHI 96 >gb|KYN05510.1| hypothetical protein ALC62_03547 [Cyphomyrmex costatus] Length = 215 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/57 (49%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +2 Query: 182 HTNTHS-THAHQIT*THTPCYTDTHSELCTHTHTLIHYCTHISQNFKSIPIFPSKIS 349 HT+TH+ TH H T THT +T TH+ THTHT H TH +SIP P IS Sbjct: 149 HTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTRTQSIPSLPQNIS 205 >ref|XP_004990473.1| hypothetical protein PTSG_08682 [Salpingoeca rosetta] gi|326432015|gb|EGD77585.1| hypothetical protein PTSG_08682 [Salpingoeca rosetta] Length = 2404 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/50 (54%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +2 Query: 158 HLFQLSSPHTNTHS---THAHQIT*THTPCYTDTHSELCTHTHTLIHYCT 298 H F LS HT+THS TH H T THT +T TH+ THTHT H CT Sbjct: 255 HTFTLSLTHTHTHSHIHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTHTCT 304 >ref|XP_001894123.1| T-cell receptor beta chain ANA 11 [Brugia malayi] Length = 133 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = +2 Query: 158 HLFQLSSPHTNTHSTHAHQIT*THTPCYTDTHSELCTHTHTLIHYCTHI 304 H++ HT+TH TH H T THT YT TH++ THTHT H THI Sbjct: 61 HIYTHIHTHTHTH-THTHTHTHTHTHTYTHTHTDTHTHTHTHTHTHTHI 108