BLASTX nr result
ID: Rehmannia27_contig00057247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00057247 (1097 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20628.1| hypothetical protein MIMGU_mgv1a015974mg [Erythra... 55 9e-06 >gb|EYU20628.1| hypothetical protein MIMGU_mgv1a015974mg [Erythranthe guttata] Length = 139 Score = 54.7 bits (130), Expect = 9e-06 Identities = 35/82 (42%), Positives = 49/82 (59%) Frame = +1 Query: 838 QKDCYTNFPNTKDGKRVLEAYWESKKMTFLKSVEFQEILAEKALDCYYHGFESCVKQLRP 1017 +K + NTK GK+V+ +SK F KS E+Q ++ YYHGF+SC+KQ+ Sbjct: 27 KKKAQQHSKNTK-GKKVVPHMQKSK---FPKSSEYQ---VPPSVHYYYHGFDSCLKQISA 79 Query: 1018 HNLNLCHLDREAGLDDLPEPAN 1083 H + LDR+AGLDDLP+ N Sbjct: 80 HLAAI--LDRDAGLDDLPQQPN 99