BLASTX nr result
ID: Rehmannia27_contig00056483
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00056483 (481 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099491.1| PREDICTED: heavy metal-associated isoprenyla... 114 7e-30 ref|XP_012856677.1| PREDICTED: heavy metal-associated isoprenyla... 110 3e-28 ref|XP_006383348.1| heavy-metal-associated domain-containing fam... 109 1e-27 ref|XP_007033097.1| Heavy metal transport/detoxification superfa... 109 1e-27 ref|XP_012089916.1| PREDICTED: heavy metal-associated isoprenyla... 107 4e-27 ref|XP_012832556.1| PREDICTED: heavy metal-associated isoprenyla... 106 1e-26 ref|XP_002272293.1| PREDICTED: heavy metal-associated isoprenyla... 106 2e-26 ref|XP_010062228.1| PREDICTED: heavy metal-associated isoprenyla... 105 3e-26 ref|XP_006430657.1| hypothetical protein CICLE_v10013659mg [Citr... 105 4e-26 emb|CDP02719.1| unnamed protein product [Coffea canephora] 104 6e-26 ref|XP_007216858.1| hypothetical protein PRUPE_ppa021641mg [Prun... 104 9e-26 ref|XP_008381309.1| PREDICTED: heavy metal-associated isoprenyla... 104 9e-26 ref|XP_009371810.1| PREDICTED: heavy metal-associated isoprenyla... 102 4e-25 ref|XP_010108935.1| hypothetical protein L484_027130 [Morus nota... 102 5e-25 ref|XP_012471712.1| PREDICTED: heavy metal-associated isoprenyla... 102 5e-25 gb|KHG07180.1| Superoxide dismutase 1 copper chaperone [Gossypiu... 102 5e-25 gb|KVI02779.1| Heavy metal-associated domain, HMA [Cynara cardun... 101 1e-24 gb|KJB08520.1| hypothetical protein B456_001G086100 [Gossypium r... 102 1e-24 gb|KYP42230.1| hypothetical protein KK1_036370 [Cajanus cajan] 101 2e-24 ref|XP_015966233.1| PREDICTED: heavy metal-associated isoprenyla... 100 3e-24 >ref|XP_011099491.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Sesamum indicum] Length = 146 Score = 114 bits (286), Expect = 7e-30 Identities = 54/56 (96%), Positives = 56/56 (100%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTRG+RKPMQTVEI+VKMDCDGCERRVKNAVKNMKGVRTVEV Sbjct: 1 MGALDYLSNFCTVTSTRGRRKPMQTVEIRVKMDCDGCERRVKNAVKNMKGVRTVEV 56 >ref|XP_012856677.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Erythranthe guttata] gi|604346092|gb|EYU44589.1| hypothetical protein MIMGU_mgv1a018204mg [Erythranthe guttata] Length = 150 Score = 110 bits (276), Expect = 3e-28 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDY SNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNA KNMKGVR+V+V Sbjct: 1 MGALDYFSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNACKNMKGVRSVDV 56 >ref|XP_006383348.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] gi|550338957|gb|ERP61145.1| heavy-metal-associated domain-containing family protein [Populus trichocarpa] Length = 146 Score = 109 bits (272), Expect = 1e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRKPMQTVEIKVKMDCDGCERRVKNAV +MKGV+TVEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKPMQTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEV 56 >ref|XP_007033097.1| Heavy metal transport/detoxification superfamily protein [Theobroma cacao] gi|508712126|gb|EOY04023.1| Heavy metal transport/detoxification superfamily protein [Theobroma cacao] Length = 155 Score = 109 bits (272), Expect = 1e-27 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRKPMQTVEIKVKMDCDGCERRVKNAV +MKGV+TVEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKPMQTVEIKVKMDCDGCERRVKNAVTSMKGVKTVEV 56 >ref|XP_012089916.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Jatropha curcas] gi|643706676|gb|KDP22659.1| hypothetical protein JCGZ_02501 [Jatropha curcas] Length = 146 Score = 107 bits (268), Expect = 4e-27 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGA+DYLSNFCTVTSTR KRKPMQTVEIKVKMDCDGCERRVKNAV +M+GV+TVEV Sbjct: 1 MGAIDYLSNFCTVTSTRSKRKPMQTVEIKVKMDCDGCERRVKNAVSSMRGVKTVEV 56 >ref|XP_012832556.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Erythranthe guttata] gi|604342261|gb|EYU41325.1| hypothetical protein MIMGU_mgv1a026598mg [Erythranthe guttata] Length = 145 Score = 106 bits (265), Expect = 1e-26 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTS R KRK MQTVEIKVKMDCDGCERRVKNAVKN+KGV+TVEV Sbjct: 1 MGALDYLSNFCTVTSPRSKRKSMQTVEIKVKMDCDGCERRVKNAVKNIKGVKTVEV 56 >ref|XP_002272293.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Vitis vinifera] gi|296087186|emb|CBI33560.3| unnamed protein product [Vitis vinifera] Length = 146 Score = 106 bits (264), Expect = 2e-26 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDY SNFCTVTST+GKRKPMQTVEIKVKMDCDGCERRVKNAV +M+GV++VEV Sbjct: 1 MGALDYFSNFCTVTSTKGKRKPMQTVEIKVKMDCDGCERRVKNAVTSMRGVKSVEV 56 >ref|XP_010062228.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Eucalyptus grandis] Length = 148 Score = 105 bits (262), Expect = 3e-26 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KR+PMQTVEIKVKMDCDGCERRVKNAV M+GV++VEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRRPMQTVEIKVKMDCDGCERRVKNAVNTMRGVKSVEV 56 >ref|XP_006430657.1| hypothetical protein CICLE_v10013659mg [Citrus clementina] gi|568857203|ref|XP_006482156.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Citrus sinensis] gi|557532714|gb|ESR43897.1| hypothetical protein CICLE_v10013659mg [Citrus clementina] gi|641806488|gb|KDO36137.1| hypothetical protein CISIN_1g032155mg [Citrus sinensis] Length = 146 Score = 105 bits (261), Expect = 4e-26 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRK MQTVEIKVKMDCDGCERRVKNAV +MKGV++VEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKNAVNSMKGVKSVEV 56 >emb|CDP02719.1| unnamed protein product [Coffea canephora] Length = 147 Score = 104 bits (260), Expect = 6e-26 Identities = 51/57 (89%), Positives = 55/57 (96%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTR-GKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRKPMQTVEIKVKMDCDGCERRVKNAVK+MKG++T+EV Sbjct: 1 MGALDYLSNFCTVTSTRRSKRKPMQTVEIKVKMDCDGCERRVKNAVKDMKGLKTLEV 57 >ref|XP_007216858.1| hypothetical protein PRUPE_ppa021641mg [Prunus persica] gi|645246396|ref|XP_008229335.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 [Prunus mume] gi|462413008|gb|EMJ18057.1| hypothetical protein PRUPE_ppa021641mg [Prunus persica] Length = 147 Score = 104 bits (259), Expect = 9e-26 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRK MQTVEIKVKMDCDGCERRVKNAV +MKGV+ VEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKNAVTSMKGVKAVEV 56 >ref|XP_008381309.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26 isoform X1 [Malus domestica] Length = 148 Score = 104 bits (259), Expect = 9e-26 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRK MQTVEIKVKMDCDGCERRVK+AV +MKGV+TVEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKHAVTSMKGVKTVEV 56 >ref|XP_009371810.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Pyrus x bretschneideri] Length = 148 Score = 102 bits (255), Expect = 4e-25 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR KRK MQTVEIKVKMDCDGCERRVK+AV +MKGV++VEV Sbjct: 1 MGALDYLSNFCTVTSTRSKRKAMQTVEIKVKMDCDGCERRVKHAVTSMKGVKSVEV 56 >ref|XP_010108935.1| hypothetical protein L484_027130 [Morus notabilis] gi|587933612|gb|EXC20575.1| hypothetical protein L484_027130 [Morus notabilis] Length = 146 Score = 102 bits (254), Expect = 5e-25 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYL NFCTV STR KRKPMQTVEIKVKMDCDGCER++KNAVK+M+GV++VEV Sbjct: 1 MGALDYLPNFCTVISTRRKRKPMQTVEIKVKMDCDGCERKIKNAVKSMRGVKSVEV 56 >ref|XP_012471712.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform X1 [Gossypium raimondii] Length = 148 Score = 102 bits (254), Expect = 5e-25 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDY+SNFCTV+ R KRKPMQTVEIKVKMDCDGCERRVKNAV NMKGV++VEV Sbjct: 1 MGALDYISNFCTVSRRRTKRKPMQTVEIKVKMDCDGCERRVKNAVTNMKGVKSVEV 56 >gb|KHG07180.1| Superoxide dismutase 1 copper chaperone [Gossypium arboreum] Length = 148 Score = 102 bits (254), Expect = 5e-25 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDY+SNFCTV+ R KRKPMQTVEIKVKMDCDGCERRVKNAV NMKGV++VEV Sbjct: 1 MGALDYISNFCTVSRRRTKRKPMQTVEIKVKMDCDGCERRVKNAVTNMKGVKSVEV 56 >gb|KVI02779.1| Heavy metal-associated domain, HMA [Cynara cardunculus var. scolymus] Length = 148 Score = 101 bits (252), Expect = 1e-24 Identities = 49/58 (84%), Positives = 55/58 (94%), Gaps = 2/58 (3%) Frame = -3 Query: 170 MGALDYLSNFCTVTST--RGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTST R +RKPMQTVEIKVKMDCDGCERRV+N+VK+MKGV++VEV Sbjct: 1 MGALDYLSNFCTVTSTSTRSRRKPMQTVEIKVKMDCDGCERRVRNSVKSMKGVKSVEV 58 >gb|KJB08520.1| hypothetical protein B456_001G086100 [Gossypium raimondii] Length = 183 Score = 102 bits (254), Expect = 1e-24 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDY+SNFCTV+ R KRKPMQTVEIKVKMDCDGCERRVKNAV NMKGV++VEV Sbjct: 36 MGALDYISNFCTVSRRRTKRKPMQTVEIKVKMDCDGCERRVKNAVTNMKGVKSVEV 91 >gb|KYP42230.1| hypothetical protein KK1_036370 [Cajanus cajan] Length = 149 Score = 101 bits (251), Expect = 2e-24 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVTSTR K KPMQTVEIKV+MDCDGCERRV+NAV ++KGV+ VEV Sbjct: 1 MGALDYLSNFCTVTSTRTKHKPMQTVEIKVRMDCDGCERRVRNAVSSLKGVKCVEV 56 >ref|XP_015966233.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Arachis duranensis] Length = 147 Score = 100 bits (249), Expect = 3e-24 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -3 Query: 170 MGALDYLSNFCTVTSTRGKRKPMQTVEIKVKMDCDGCERRVKNAVKNMKGVRTVEV 3 MGALDYLSNFCTVT+TR K K MQTVEIKVKMDCDGCERRV+NAV +MKGV++VEV Sbjct: 1 MGALDYLSNFCTVTTTRSKHKAMQTVEIKVKMDCDGCERRVRNAVTSMKGVKSVEV 56