BLASTX nr result
ID: Rehmannia27_contig00056342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00056342 (428 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102622.1| hypothetical protein L484_010911 [Morus nota... 55 5e-07 >ref|XP_010102622.1| hypothetical protein L484_010911 [Morus notabilis] gi|587905632|gb|EXB93772.1| hypothetical protein L484_010911 [Morus notabilis] Length = 124 Score = 54.7 bits (130), Expect = 5e-07 Identities = 23/56 (41%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +2 Query: 221 SSNILPNLNT-LTLRLDHGNYVYWRAQVLSTVCAHGFEDFLLGSSIAPPKFLSSDP 385 S +P +N L+++LD N++ W+ Q+L+ + AHGF+DF+ GS PP+FL++ P Sbjct: 33 SITTIPTVNPQLSIKLDDDNFLLWKNQMLNIIIAHGFDDFIDGSRPCPPRFLANQP 88