BLASTX nr result
ID: Rehmannia27_contig00054959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054959 (375 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35850.1| hypothetical protein MIMGU_mgv1a011859mg [Erythra... 87 3e-18 gb|EYU35852.1| hypothetical protein MIMGU_mgv1a012470mg [Erythra... 79 1e-15 ref|XP_012839306.1| PREDICTED: uncharacterized protein LOC105959... 79 2e-15 >gb|EYU35850.1| hypothetical protein MIMGU_mgv1a011859mg [Erythranthe guttata] Length = 268 Score = 86.7 bits (213), Expect = 3e-18 Identities = 46/89 (51%), Positives = 63/89 (70%), Gaps = 3/89 (3%) Frame = -3 Query: 367 EEDLTTCVDDL-GKVESTAVIEVREKVLRVKEYVSNTGEFVFSYDDVWHYFWSEIAA-NW 194 E+DL CVD L VESTAV E R KVLRV Y+S++ EF Y + H + ++A +W Sbjct: 177 EDDLNPCVDYLLDDVESTAVSEARAKVLRVMVYLSSSREFAGRYYEDMHQRYRDVAVVDW 236 Query: 193 -GMMFENMFLVCICGLQLLFIFYLFWSLF 110 M+ ++MF++CICGLQLLFIF+L+W+LF Sbjct: 237 RNMVSDHMFIICICGLQLLFIFFLYWTLF 265 >gb|EYU35852.1| hypothetical protein MIMGU_mgv1a012470mg [Erythranthe guttata] Length = 249 Score = 79.3 bits (194), Expect = 1e-15 Identities = 45/91 (49%), Positives = 61/91 (67%), Gaps = 4/91 (4%) Frame = -3 Query: 373 AVEEDLTTCVDDLGKVE--STAVIEVREKVLRVKEYVSNTGEFVFSYDD--VWHYFWSEI 206 A EEDL TCV DLGKVE STAVIE+R KVL ++ + G+F+ D+ V H WS+I Sbjct: 158 AAEEDLETCVGDLGKVEMESTAVIELRMKVLDALVHLRSRGDFLVYSDEYKVTHSLWSDI 217 Query: 205 AANWGMMFENMFLVCICGLQLLFIFYLFWSL 113 A + +F+V +C LQL+FIF+LFW++ Sbjct: 218 ADE---ISNYLFVVLVCCLQLMFIFFLFWTI 245 >ref|XP_012839306.1| PREDICTED: uncharacterized protein LOC105959717 isoform X1 [Erythranthe guttata] gi|848877748|ref|XP_012839307.1| PREDICTED: uncharacterized protein LOC105959717 isoform X2 [Erythranthe guttata] Length = 271 Score = 79.3 bits (194), Expect = 2e-15 Identities = 41/89 (46%), Positives = 64/89 (71%), Gaps = 3/89 (3%) Frame = -3 Query: 367 EEDLTTCVDDLGKVESTAVIE-VREKVLRVKEYVSNTGEFVFSYDDVWHYFWSEIAANW- 194 +E+L +CV +G++ESTA IE VR +VLRV Y+ ++GE + Y F S++A ++ Sbjct: 180 KENLMSCVRGMGEMESTAEIEEVRAEVLRVIVYLRSSGENLVRYRKFVREFHSDVAGDYW 239 Query: 193 -GMMFENMFLVCICGLQLLFIFYLFWSLF 110 M+ +NMF++ +CGLQL+FIF+L+WSLF Sbjct: 240 RNMISDNMFIISMCGLQLVFIFFLYWSLF 268