BLASTX nr result
ID: Rehmannia27_contig00054878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054878 (815 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29679.1| hypothetical protein MIMGU_mgv1a017470mg [Erythra... 78 2e-15 >gb|EYU29679.1| hypothetical protein MIMGU_mgv1a017470mg [Erythranthe guttata] Length = 72 Score = 78.2 bits (191), Expect = 2e-15 Identities = 37/66 (56%), Positives = 44/66 (66%) Frame = -1 Query: 740 MKTWIIVFVASLLIFGFINETHAKHVYKKNRRLLSNEVNRTVPGGPSGCPHCLGDAKSRF 561 MKTW+++FVASLLI G I T K + R L +NEVNR VPGGP+ C HC GD+K Sbjct: 1 MKTWVVLFVASLLIVGSIGRTDPKFANTEKRMLRNNEVNRNVPGGPNICYHCFGDSKVPA 60 Query: 560 RFPPPA 543 R PP A Sbjct: 61 RVPPSA 66