BLASTX nr result
ID: Rehmannia27_contig00054463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054463 (454 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098959.1| PREDICTED: ethylene-responsive transcription... 57 2e-07 >ref|XP_011098959.1| PREDICTED: ethylene-responsive transcription factor ERF022-like [Sesamum indicum] Length = 174 Score = 57.4 bits (137), Expect = 2e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 95 MEKNGWNECPTSNNIGVRKRKWGRWVSEIRE 3 M+++GWNEC TS IGVRKRK+GRWVSEIRE Sbjct: 1 MKRHGWNECTTSKYIGVRKRKYGRWVSEIRE 31