BLASTX nr result
ID: Rehmannia27_contig00054448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054448 (519 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010680866.1| PREDICTED: uncharacterized protein LOC104895... 89 1e-17 ref|XP_012857659.1| PREDICTED: uncharacterized protein LOC105976... 89 1e-17 ref|XP_010684012.1| PREDICTED: uncharacterized protein LOC104898... 89 2e-17 gb|KYP48259.1| Retrovirus-related Pol polyprotein from transposo... 86 6e-17 gb|KYP74810.1| Retrovirus-related Pol polyprotein from transposo... 86 1e-16 ref|XP_009612658.1| PREDICTED: uncharacterized protein LOC104105... 86 1e-16 emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] 86 2e-16 emb|CAN59949.1| hypothetical protein VITISV_043423 [Vitis vinifera] 85 4e-16 emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera] 85 4e-16 emb|CAN65808.1| hypothetical protein VITISV_033389 [Vitis vinifera] 85 4e-16 emb|CAN73437.1| hypothetical protein VITISV_031733 [Vitis vinifera] 85 4e-16 ref|XP_009759282.1| PREDICTED: uncharacterized protein LOC104211... 84 5e-16 gb|KYP33262.1| Retrovirus-related Pol polyprotein from transposo... 84 5e-16 emb|CAN63908.1| hypothetical protein VITISV_044218 [Vitis vinifera] 84 6e-16 ref|XP_010246512.1| PREDICTED: uncharacterized protein LOC104589... 82 6e-16 gb|KYP49743.1| Retrovirus-related Pol polyprotein from transposo... 83 7e-16 ref|XP_012080265.1| PREDICTED: uncharacterized protein LOC105640... 84 7e-16 gb|KYP65700.1| Retrovirus-related Pol polyprotein from transposo... 82 1e-15 ref|XP_011071708.1| PREDICTED: uncharacterized protein LOC105157... 83 1e-15 gb|KYP65734.1| Retrovirus-related Pol polyprotein from transposo... 83 1e-15 >ref|XP_010680866.1| PREDICTED: uncharacterized protein LOC104895918 [Beta vulgaris subsp. vulgaris] Length = 939 Score = 89.4 bits (220), Expect = 1e-17 Identities = 41/72 (56%), Positives = 52/72 (72%) Frame = +3 Query: 3 RLKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSE 182 +LK FGCL FA + +K KF+PRA KC+ LGY G+KG+++ DLETH FVSRDV F E Sbjct: 584 QLKVFGCLCFAYNNDRSKDKFSPRAKKCLFLGYPFGQKGFKVYDLETHKCFVSRDVIFQE 643 Query: 183 HIFPFHSIHNPS 218 IFPF + +PS Sbjct: 644 SIFPFKNSDSPS 655 >ref|XP_012857659.1| PREDICTED: uncharacterized protein LOC105976934 [Erythranthe guttata] Length = 944 Score = 89.4 bits (220), Expect = 1e-17 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK+FGCL FATD +KSKF PRA CV LGY +G KGY+L DL +H +F+SRDV F E+ Sbjct: 755 LKSFGCLVFATDVSGHKSKFDPRANACVFLGYPSGIKGYKLLDLVSHKVFISRDVIFHEN 814 Query: 186 IFPF 197 I+PF Sbjct: 815 IYPF 818 >ref|XP_010684012.1| PREDICTED: uncharacterized protein LOC104898614 [Beta vulgaris subsp. vulgaris] Length = 770 Score = 88.6 bits (218), Expect = 2e-17 Identities = 37/66 (56%), Positives = 49/66 (74%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 +K FGC FA + NK KF+PRATKC+ +GY G+KGY++ D+++H FV+RDV F EH Sbjct: 470 IKVFGCQCFAYNIDRNKDKFSPRATKCIFIGYPFGQKGYKVYDMDSHKCFVTRDVVFQEH 529 Query: 186 IFPFHS 203 I PFHS Sbjct: 530 IIPFHS 535 >gb|KYP48259.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 365 Score = 86.3 bits (212), Expect = 6e-17 Identities = 40/69 (57%), Positives = 48/69 (69%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK+FGCL FA + KF+PR+T CV +GY G KGY+L DL+T IF+SRDV F E Sbjct: 25 LKSFGCLCFAATLSSQRVKFSPRSTTCVFIGYPLGVKGYKLYDLQTKKIFLSRDVMFHES 84 Query: 186 IFPFHSIHN 212 FPFHSI N Sbjct: 85 TFPFHSIIN 93 >gb|KYP74810.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 669 Score = 86.3 bits (212), Expect = 1e-16 Identities = 35/65 (53%), Positives = 46/65 (70%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK+FGCL FA + KF+PR+T C+ +GY G KGY+LCD++T +FVSRDV F E Sbjct: 405 LKSFGCLCFAATLNSQRDKFSPRSTTCIFIGYPLGMKGYKLCDIQTKRVFVSRDVIFHET 464 Query: 186 IFPFH 200 FP+H Sbjct: 465 TFPYH 469 >ref|XP_009612658.1| PREDICTED: uncharacterized protein LOC104105930 [Nicotiana tomentosiformis] Length = 911 Score = 86.3 bits (212), Expect = 1e-16 Identities = 42/73 (57%), Positives = 51/73 (69%), Gaps = 3/73 (4%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L+AFGCL ++T +P++ K PRAT CV LGY KKGY+L DL+ H FVSRDV F EH Sbjct: 710 LRAFGCLCYSTVPKPHRDKLQPRATPCVFLGYPFAKKGYKLYDLKHHTCFVSRDVTFHEH 769 Query: 186 IFPF---HSIHNP 215 IFPF S H+P Sbjct: 770 IFPFIQTTSKHSP 782 >emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera] Length = 1813 Score = 85.9 bits (211), Expect = 2e-16 Identities = 44/78 (56%), Positives = 53/78 (67%), Gaps = 6/78 (7%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L+ FGC + T+ P K KF PRA+ CV LGY GKKGY++ DL+T I VSRDVFF E+ Sbjct: 989 LRVFGCECYVTNVHP-KQKFDPRASICVFLGYPHGKKGYKVLDLQTQKISVSRDVFFREN 1047 Query: 186 IFPFHSI------HNPSL 221 IFPFHS H+PSL Sbjct: 1048 IFPFHSSSSQSQQHSPSL 1065 >emb|CAN59949.1| hypothetical protein VITISV_043423 [Vitis vinifera] Length = 1059 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 ++ FGCLA+AT+ KFAPRA +C+ LGY G+K Y+L DL+TH +F SRDV F E Sbjct: 736 IRVFGCLAYATNVHV-PHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVVFHET 794 Query: 186 IFPFHSIHNPS 218 IFP+ SI +PS Sbjct: 795 IFPYESIPSPS 805 >emb|CAN82526.1| hypothetical protein VITISV_028058 [Vitis vinifera] Length = 1125 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 ++ FGCLA+AT+ KFAPRA +C+ LGY G+K Y+L DL+TH +F SRDV F E Sbjct: 472 IRVFGCLAYATNVHV-PHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVVFHET 530 Query: 186 IFPFHSIHNPS 218 IFP+ SI +PS Sbjct: 531 IFPYESIPSPS 541 >emb|CAN65808.1| hypothetical protein VITISV_033389 [Vitis vinifera] Length = 1279 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 ++ FGCLA+AT+ KFAPRA +C+ LGY G+K Y+L DL+TH +F SRDV F E Sbjct: 621 IRVFGCLAYATNVHV-PHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVVFHET 679 Query: 186 IFPFHSIHNPS 218 IFP+ SI +PS Sbjct: 680 IFPYESIPSPS 690 >emb|CAN73437.1| hypothetical protein VITISV_031733 [Vitis vinifera] Length = 1322 Score = 84.7 bits (208), Expect = 4e-16 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 ++ FGCLA+AT+ KFAPRA +C+ LGY G+K Y+L DL+TH +F SRDV F E Sbjct: 644 IRVFGCLAYATNVHV-PHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVVFHET 702 Query: 186 IFPFHSIHNPS 218 IFP+ SI +PS Sbjct: 703 IFPYESIPSPS 713 >ref|XP_009759282.1| PREDICTED: uncharacterized protein LOC104211846 [Nicotiana sylvestris] Length = 623 Score = 84.3 bits (207), Expect = 5e-16 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L+AFGCL ++ +P++ KF PR CVL+GY KKGY+L +LE+H FVSRDV F EH Sbjct: 423 LRAFGCLCYSIVPKPHRDKFQPRVVPCVLVGYPFAKKGYKLYNLESHSCFVSRDVVFHEH 482 Query: 186 IFPF 197 IFPF Sbjct: 483 IFPF 486 >gb|KYP33262.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 743 Score = 84.3 bits (207), Expect = 5e-16 Identities = 41/70 (58%), Positives = 46/70 (65%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK FGCL+FAT ++ K PRA KCV LGY G KGY L D+ET FVSRDV+F E Sbjct: 618 LKVFGCLSFATTPNAHRGKLDPRAKKCVHLGYKPGTKGYLLFDIETKQFFVSRDVYFYEK 677 Query: 186 IFPFHSIHNP 215 IFPF I P Sbjct: 678 IFPFTDIQPP 687 >emb|CAN63908.1| hypothetical protein VITISV_044218 [Vitis vinifera] Length = 1236 Score = 84.3 bits (207), Expect = 6e-16 Identities = 39/71 (54%), Positives = 51/71 (71%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 ++ FGCLA+AT+ KFAPRA +C+ LGY G+K Y+L DL+TH +F SRDV F E Sbjct: 719 IRVFGCLAYATNVHI-PHKFAPRAKRCIFLGYPVGQKAYKLYDLDTHQMFTSRDVVFHET 777 Query: 186 IFPFHSIHNPS 218 IFP+ SI +PS Sbjct: 778 IFPYESIPSPS 788 >ref|XP_010246512.1| PREDICTED: uncharacterized protein LOC104589776 [Nelumbo nucifera] Length = 257 Score = 82.0 bits (201), Expect = 6e-16 Identities = 35/64 (54%), Positives = 47/64 (73%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK FGCL +AT+T+P K KF+ RA KCV +GY G+K Y++ DL + +F SRDV F E+ Sbjct: 57 LKVFGCLCYATNTKPAKDKFSTRAFKCVFIGYQPGQKAYKVYDLTSKQVFTSRDVIFFEN 116 Query: 186 IFPF 197 +FPF Sbjct: 117 VFPF 120 >gb|KYP49743.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 323 Score = 82.8 bits (203), Expect = 7e-16 Identities = 41/70 (58%), Positives = 46/70 (65%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK FGCL+FAT ++ K PRA KCV LGY G KGY L D+ET FVSRDV+F E Sbjct: 127 LKVFGCLSFATTPNAHRGKPDPRAKKCVHLGYKPGTKGYLLFDIETKQFFVSRDVYFYEK 186 Query: 186 IFPFHSIHNP 215 IFPF I P Sbjct: 187 IFPFTDIQPP 196 >ref|XP_012080265.1| PREDICTED: uncharacterized protein LOC105640530 [Jatropha curcas] Length = 771 Score = 84.0 bits (206), Expect = 7e-16 Identities = 40/73 (54%), Positives = 50/73 (68%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L+ GCL FAT+T+P+K KF PRA CVLLGY A +K Y+L D+ + IF S DV F E Sbjct: 570 LRVIGCLCFATNTKPHKDKFDPRAKPCVLLGYEAQQKSYKLYDMHSKQIFYSGDVVFKET 629 Query: 186 IFPFHSIHNPSLE 224 ++PFH HN LE Sbjct: 630 VYPFH--HNTLLE 640 >gb|KYP65700.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 288 Score = 81.6 bits (200), Expect = 1e-15 Identities = 36/67 (53%), Positives = 50/67 (74%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L+ FGCLA+AT+ + KFAPRAT+C+ LGY G+K Y+L ++++H +F SRDV F E Sbjct: 60 LRGFGCLAYATNVHVSH-KFAPRATQCIFLGYPVGQKAYKLYNIDSHQVFTSRDVIFHED 118 Query: 186 IFPFHSI 206 IFP+ SI Sbjct: 119 IFPYESI 125 >ref|XP_011071708.1| PREDICTED: uncharacterized protein LOC105157106 [Sesamum indicum] Length = 577 Score = 83.2 bits (204), Expect = 1e-15 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 LK GCL FA + PN+SKF RA+KCVLLGY G+K YRL DL+++ IFVSR++ F E Sbjct: 404 LKTIGCLCFAIKSNPNQSKFDKRASKCVLLGYPPGQKAYRLLDLDSNTIFVSRNITFHED 463 Query: 186 IFPF 197 +FPF Sbjct: 464 VFPF 467 >gb|KYP65734.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1013 Score = 83.2 bits (204), Expect = 1e-15 Identities = 39/72 (54%), Positives = 51/72 (70%) Frame = +3 Query: 6 LKAFGCLAFATDTRPNKSKFAPRATKCVLLGYVAGKKGYRLCDLETHHIFVSRDVFFSEH 185 L++FGCLA+A+ + +++KF PRA K VLLGY G KGY L DL +H F+SR+VFF E Sbjct: 308 LRSFGCLAYASTLQAHRTKFQPRAKKSVLLGYKEGVKGYLLYDLHSHEFFMSRNVFFHEF 367 Query: 186 IFPFHSIHNPSL 221 FPFH+ SL Sbjct: 368 TFPFHTPSQTSL 379