BLASTX nr result
ID: Rehmannia27_contig00054406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054406 (398 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37720.1| hypothetical protein MIMGU_mgv1a000013mg [Erythra... 65 6e-10 ref|XP_012836980.1| PREDICTED: phragmoplast orienting kinesin 2 ... 65 6e-10 ref|XP_011088306.1| PREDICTED: phragmoplast orienting kinesin 2 ... 57 4e-07 ref|XP_010096170.1| Kinesin-like protein KIF15 [Morus notabilis]... 57 4e-07 ref|XP_007200943.1| hypothetical protein PRUPE_ppa000013mg [Prun... 57 8e-07 ref|XP_010647790.1| PREDICTED: phragmoplast orienting kinesin 2 ... 56 1e-06 ref|XP_010647789.1| PREDICTED: phragmoplast orienting kinesin 2 ... 56 1e-06 ref|XP_006384462.1| kinesin motor family protein [Populus tricho... 55 2e-06 ref|XP_007042338.1| ATP binding protein, putative isoform 2 [The... 55 4e-06 ref|XP_011458341.1| PREDICTED: phragmoplast orienting kinesin 2 ... 55 4e-06 ref|XP_007042337.1| ATP binding protein, putative isoform 1 [The... 55 4e-06 ref|XP_015874230.1| PREDICTED: phragmoplast orienting kinesin 2 ... 54 5e-06 ref|XP_011001183.1| PREDICTED: phragmoplast orienting kinesin 2 ... 54 9e-06 >gb|EYU37720.1| hypothetical protein MIMGU_mgv1a000013mg [Erythranthe guttata] Length = 2802 Score = 65.5 bits (158), Expect = 6e-10 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 397 RISDERVRLSELRPQ-TSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 RISDER+RLSELRPQ ST SS+R DENR V RVSQTPFLS+ DR Sbjct: 2757 RISDERIRLSELRPQQASTESSARPDENRVVRNRVSQTPFLSSLDR 2802 >ref|XP_012836980.1| PREDICTED: phragmoplast orienting kinesin 2 [Erythranthe guttata] Length = 2894 Score = 65.5 bits (158), Expect = 6e-10 Identities = 35/46 (76%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 397 RISDERVRLSELRPQ-TSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 RISDER+RLSELRPQ ST SS+R DENR V RVSQTPFLS+ DR Sbjct: 2849 RISDERIRLSELRPQQASTESSARPDENRVVRNRVSQTPFLSSLDR 2894 >ref|XP_011088306.1| PREDICTED: phragmoplast orienting kinesin 2 [Sesamum indicum] Length = 2928 Score = 57.4 bits (137), Expect = 4e-07 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 RIS+ER+RLSELRPQ+STA SSR+D+N QV SQ FLS FDR Sbjct: 2885 RISEERIRLSELRPQSSTA-SSRADDNYQVRNGASQPQFLSPFDR 2928 >ref|XP_010096170.1| Kinesin-like protein KIF15 [Morus notabilis] gi|587874427|gb|EXB63565.1| Kinesin-like protein KIF15 [Morus notabilis] Length = 2985 Score = 57.4 bits (137), Expect = 4e-07 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I++ER+RLSEL PQ+S SS R+DENRQ P+RVSQ P+ S DR Sbjct: 2942 KITNERIRLSELMPQSSPISS-RADENRQTPKRVSQAPYFSPLDR 2985 >ref|XP_007200943.1| hypothetical protein PRUPE_ppa000013mg [Prunus persica] gi|462396343|gb|EMJ02142.1| hypothetical protein PRUPE_ppa000013mg [Prunus persica] Length = 2918 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +IS ER+RLSEL PQ S SS R+DENRQ P+R+SQ P+ S DR Sbjct: 2875 KISSERIRLSELMPQASPISS-RADENRQTPKRMSQAPYFSPLDR 2918 >ref|XP_010647790.1| PREDICTED: phragmoplast orienting kinesin 2 isoform X2 [Vitis vinifera] Length = 3083 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I +ER+RLSEL PQ S SS R+DEN P+RVSQTPFLSA DR Sbjct: 3040 KIVNERIRLSELVPQPSPLSS-RTDENHLTPQRVSQTPFLSALDR 3083 >ref|XP_010647789.1| PREDICTED: phragmoplast orienting kinesin 2 isoform X1 [Vitis vinifera] Length = 3116 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I +ER+RLSEL PQ S SS R+DEN P+RVSQTPFLSA DR Sbjct: 3073 KIVNERIRLSELVPQPSPLSS-RTDENHLTPQRVSQTPFLSALDR 3116 >ref|XP_006384462.1| kinesin motor family protein [Populus trichocarpa] gi|550341080|gb|ERP62259.1| kinesin motor family protein [Populus trichocarpa] Length = 2731 Score = 55.5 bits (132), Expect = 2e-06 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I++ER+RLSELRPQTS +SR+D+NRQ PRR Q PF SA DR Sbjct: 2689 KITNERIRLSELRPQTSPI-NSRTDDNRQTPRR-GQVPFFSALDR 2731 >ref|XP_007042338.1| ATP binding protein, putative isoform 2 [Theobroma cacao] gi|508706273|gb|EOX98169.1| ATP binding protein, putative isoform 2 [Theobroma cacao] Length = 2767 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 RI+ ER RLSEL PQTS SSS +DEN PRRV Q PFLS DR Sbjct: 2724 RITSERNRLSELMPQTSPVSSS-TDENCHTPRRVPQAPFLSTLDR 2767 >ref|XP_011458341.1| PREDICTED: phragmoplast orienting kinesin 2 [Fragaria vesca subsp. vesca] Length = 2901 Score = 54.7 bits (130), Expect = 4e-06 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I+ ER+RLSEL PQ S SS+ DEN Q PRR+SQ P+LSA DR Sbjct: 2858 KITSERLRLSELMPQASP-KSSKPDENCQTPRRMSQAPYLSALDR 2901 >ref|XP_007042337.1| ATP binding protein, putative isoform 1 [Theobroma cacao] gi|508706272|gb|EOX98168.1| ATP binding protein, putative isoform 1 [Theobroma cacao] Length = 2916 Score = 54.7 bits (130), Expect = 4e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 RI+ ER RLSEL PQTS SSS +DEN PRRV Q PFLS DR Sbjct: 2873 RITSERNRLSELMPQTSPVSSS-TDENCHTPRRVPQAPFLSTLDR 2916 >ref|XP_015874230.1| PREDICTED: phragmoplast orienting kinesin 2 [Ziziphus jujuba] Length = 1994 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I+ ER+RLSEL+PQ+S SS R+D+N Q+ +RVSQ P+ SA DR Sbjct: 1951 KIASERIRLSELKPQSSPISS-RADDNSQIAKRVSQPPYFSALDR 1994 >ref|XP_011001183.1| PREDICTED: phragmoplast orienting kinesin 2 [Populus euphratica] Length = 2979 Score = 53.5 bits (127), Expect = 9e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 397 RISDERVRLSELRPQTSTASSSRSDENRQVPRRVSQTPFLSAFDR 263 +I++ER+RLSELRP TS +SR+D+NRQ PRR Q PF SA DR Sbjct: 2937 KITNERIRLSELRPHTSPI-NSRTDDNRQTPRR-GQVPFFSALDR 2979