BLASTX nr result
ID: Rehmannia27_contig00054361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054361 (377 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071276.1| PREDICTED: probable calcium-binding protein ... 127 6e-35 ref|XP_011075637.1| PREDICTED: probable calcium-binding protein ... 122 7e-34 ref|XP_012855233.1| PREDICTED: troponin C, skeletal muscle-like ... 108 2e-27 ref|XP_012458137.1| PREDICTED: probable calcium-binding protein ... 103 8e-26 ref|XP_012458411.1| PREDICTED: probable calcium-binding protein ... 103 1e-25 gb|KJB75730.1| hypothetical protein B456_012G053700 [Gossypium r... 103 1e-25 ref|XP_007022732.1| Calcium-binding EF-hand family protein, puta... 102 4e-25 ref|XP_010552843.1| PREDICTED: probable calcium-binding protein ... 103 7e-25 ref|XP_015962752.1| PREDICTED: probable calcium-binding protein ... 100 3e-24 ref|XP_009360612.1| PREDICTED: probable calcium-binding protein ... 100 4e-24 ref|XP_003534444.1| PREDICTED: probable calcium-binding protein ... 99 1e-23 gb|ACU19070.1| unknown [Glycine max] 99 1e-23 ref|XP_004491817.1| PREDICTED: probable calcium-binding protein ... 98 3e-23 ref|XP_006443407.1| hypothetical protein CICLE_v10024475mg, part... 96 3e-23 ref|XP_014625776.1| PREDICTED: probable calcium-binding protein ... 96 5e-23 gb|KHN11619.1| Putative calcium-binding protein CML45 [Glycine s... 98 5e-23 ref|XP_008341587.1| PREDICTED: probable calcium-binding protein ... 97 5e-23 ref|XP_009781412.1| PREDICTED: probable calcium-binding protein ... 95 5e-23 ref|XP_012489589.1| PREDICTED: probable calcium-binding protein ... 97 7e-23 ref|XP_002323865.1| hypothetical protein POPTR_0017s12100g [Popu... 97 7e-23 >ref|XP_011071276.1| PREDICTED: probable calcium-binding protein CML45 [Sesamum indicum] Length = 194 Score = 127 bits (320), Expect = 6e-35 Identities = 61/73 (83%), Positives = 64/73 (87%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLKCNLEECDGMIRKFDGNGDGLID 117 EEPSLEEIKETFGVFDVNKDGFIDGSELQ VLCSLGL+ LEEC MI FDGNGDGLID Sbjct: 122 EEPSLEEIKETFGVFDVNKDGFIDGSELQTVLCSLGLEFRLEECKRMIVAFDGNGDGLID 181 Query: 116 FRDFVKLMENCLC 78 F+DF+K ME CLC Sbjct: 182 FQDFLKFMERCLC 194 >ref|XP_011075637.1| PREDICTED: probable calcium-binding protein CML45 [Sesamum indicum] Length = 110 Score = 122 bits (306), Expect = 7e-34 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 EEPSLEEI+E+FGVFD N DGFID SELQRV+C+LGLK C LE+C MI+ FDGNGDGL Sbjct: 36 EEPSLEEIRESFGVFDANNDGFIDCSELQRVVCNLGLKEGCELEDCKKMIKAFDGNGDGL 95 Query: 122 IDFRDFVKLMENCLC 78 IDF+DF+KLME+CLC Sbjct: 96 IDFQDFIKLMESCLC 110 >ref|XP_012855233.1| PREDICTED: troponin C, skeletal muscle-like [Erythranthe guttata] gi|604302884|gb|EYU22409.1| hypothetical protein MIMGU_mgv1a014043mg [Erythranthe guttata] Length = 202 Score = 108 bits (271), Expect = 2e-27 Identities = 55/77 (71%), Positives = 59/77 (76%), Gaps = 4/77 (5%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVL-CSLGLK---CNLEECDGMIRKFDGNGD 129 EEPS EEIKETF VFD NKDGFID ELQRVL C GL+ CNLEEC MI+ FD NGD Sbjct: 126 EEPSFEEIKETFEVFDANKDGFIDACELQRVLVCVFGLEGSGCNLEECKRMIKSFDANGD 185 Query: 128 GLIDFRDFVKLMENCLC 78 GLIDF++FV ME CLC Sbjct: 186 GLIDFQEFVIFMEKCLC 202 >ref|XP_012458137.1| PREDICTED: probable calcium-binding protein CML45 [Gossypium raimondii] Length = 148 Score = 103 bits (256), Expect = 8e-26 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFDVNKDGFID ELQR+LC LGLK LE C+ MI FD +GDG Sbjct: 74 QEPSLEEVKQAFDVFDVNKDGFIDAEELQRILCVLGLKQGLKLENCNNMINTFDEDGDGR 133 Query: 122 IDFRDFVKLMENCLC 78 IDF++FVK MEN C Sbjct: 134 IDFQEFVKFMENSFC 148 >ref|XP_012458411.1| PREDICTED: probable calcium-binding protein CML45 [Gossypium raimondii] gi|763808814|gb|KJB75716.1| hypothetical protein B456_012G053200 [Gossypium raimondii] Length = 178 Score = 103 bits (257), Expect = 1e-25 Identities = 50/75 (66%), Positives = 57/75 (76%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFDVNKDGFID ELQRVLC LGLK LE C+ MI FD +GDG Sbjct: 104 QEPSLEEVKQAFDVFDVNKDGFIDAEELQRVLCVLGLKQGLKLENCNNMINTFDEDGDGR 163 Query: 122 IDFRDFVKLMENCLC 78 IDF++FVK MEN C Sbjct: 164 IDFQEFVKFMENSFC 178 >gb|KJB75730.1| hypothetical protein B456_012G053700 [Gossypium raimondii] Length = 166 Score = 103 bits (256), Expect = 1e-25 Identities = 49/75 (65%), Positives = 57/75 (76%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFDVNKDGFID ELQR+LC LGLK LE C+ MI FD +GDG Sbjct: 92 QEPSLEEVKQAFDVFDVNKDGFIDAEELQRILCVLGLKQGLKLENCNNMINTFDEDGDGR 151 Query: 122 IDFRDFVKLMENCLC 78 IDF++FVK MEN C Sbjct: 152 IDFQEFVKFMENSFC 166 >ref|XP_007022732.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao] gi|508722360|gb|EOY14257.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao] Length = 166 Score = 102 bits (253), Expect = 4e-25 Identities = 49/75 (65%), Positives = 59/75 (78%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 EEPSLEE+K+ F VFDVNKDGFID ELQ+VLC LGLK LE C+ MI+ FD +GDG Sbjct: 92 EEPSLEEVKQAFNVFDVNKDGFIDAEELQKVLCILGLKEGLKLENCNKMIKTFDEDGDGR 151 Query: 122 IDFRDFVKLMENCLC 78 I+F++FVKLME+ C Sbjct: 152 IEFQEFVKLMESSFC 166 >ref|XP_010552843.1| PREDICTED: probable calcium-binding protein CML45 [Tarenaya hassleriana] Length = 268 Score = 103 bits (258), Expect = 7e-25 Identities = 51/75 (68%), Positives = 59/75 (78%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+KE F VFDVN+DGFID +ELQRVL +LGLK +LE C MIR FDGN DG+ Sbjct: 194 KEPSLEEVKEAFDVFDVNRDGFIDATELQRVLTTLGLKEGSDLENCRKMIRSFDGNEDGM 253 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK MEN C Sbjct: 254 IDFHEFVKFMENRFC 268 >ref|XP_015962752.1| PREDICTED: probable calcium-binding protein CML30 [Arachis duranensis] Length = 196 Score = 100 bits (249), Expect = 3e-24 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSL+E+K+ F VFD NKDGFID ELQRVLC LGLK N+E C+ MIRKFD N DG Sbjct: 121 QEPSLDEVKQAFDVFDENKDGFIDAMELQRVLCILGLKEARNVENCEKMIRKFDENKDGR 180 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK+ME+ C Sbjct: 181 IDFNEFVKIMEHRFC 195 >ref|XP_009360612.1| PREDICTED: probable calcium-binding protein CML45 [Pyrus x bretschneideri] Length = 195 Score = 100 bits (248), Expect = 4e-24 Identities = 50/75 (66%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSL E+KE F VFD NKDGFID ELQRVLC LGLK LE+C MIR FD NGDG Sbjct: 121 KEPSLGEVKEAFNVFDENKDGFIDARELQRVLCILGLKEGSKLEDCQKMIRSFDKNGDGR 180 Query: 122 IDFRDFVKLMENCLC 78 I+F +FVK+ME LC Sbjct: 181 IEFNEFVKVMEASLC 195 >ref|XP_003534444.1| PREDICTED: probable calcium-binding protein CML45 [Glycine max] gi|947091416|gb|KRH40081.1| hypothetical protein GLYMA_09G236800 [Glycine max] Length = 207 Score = 99.4 bits (246), Expect = 1e-23 Identities = 50/75 (66%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFD NKDGFID ELQRVLC LGLK LE C+ MIR FD N DG Sbjct: 133 QEPSLEEVKQAFDVFDENKDGFIDAKELQRVLCILGLKEAAELENCNKMIRIFDTNQDGR 192 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK+MEN C Sbjct: 193 IDFIEFVKIMENRFC 207 >gb|ACU19070.1| unknown [Glycine max] Length = 207 Score = 99.4 bits (246), Expect = 1e-23 Identities = 50/75 (66%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFD NKDGFID ELQRVLC LGLK LE C+ MIR FD N DG Sbjct: 133 QEPSLEEVKQAFDVFDENKDGFIDAKELQRVLCILGLKEAAELENCNKMIRIFDTNQDGR 192 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK+MEN C Sbjct: 193 IDFIEFVKIMENRFC 207 >ref|XP_004491817.1| PREDICTED: probable calcium-binding protein CML45 [Cicer arietinum] Length = 200 Score = 98.2 bits (243), Expect = 3e-23 Identities = 49/75 (65%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLKCNLE--ECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFD NKDGFID ELQRV+C LGLK LE C MI+ FD N DG Sbjct: 126 QEPSLEEVKQAFDVFDENKDGFIDAEELQRVMCILGLKEGLEVQNCQKMIKNFDENQDGR 185 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK+MEN LC Sbjct: 186 IDFIEFVKIMENRLC 200 >ref|XP_006443407.1| hypothetical protein CICLE_v10024475mg, partial [Citrus clementina] gi|557545669|gb|ESR56647.1| hypothetical protein CICLE_v10024475mg, partial [Citrus clementina] Length = 112 Score = 95.5 bits (236), Expect = 3e-23 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 2/72 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFD NKDGFID ELQRVLC LG+K LE C MI+ FD NGDG Sbjct: 36 KEPSLEEVKDAFDVFDENKDGFIDALELQRVLCILGMKEGFQLENCKKMIKTFDENGDGS 95 Query: 122 IDFRDFVKLMEN 87 IDF++FVK ME+ Sbjct: 96 IDFKEFVKFMES 107 >ref|XP_014625776.1| PREDICTED: probable calcium-binding protein CML45 isoform X2 [Glycine max] gi|947051662|gb|KRH01191.1| hypothetical protein GLYMA_18G260700 [Glycine max] Length = 151 Score = 96.3 bits (238), Expect = 5e-23 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 2/72 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F VFD NKDGFID ELQRVLC LGLK LE C MIR FD N DG Sbjct: 77 QEPSLEEVKQAFDVFDENKDGFIDAEELQRVLCILGLKEAAKLENCHKMIRIFDTNQDGR 136 Query: 122 IDFRDFVKLMEN 87 IDF +FVK+MEN Sbjct: 137 IDFIEFVKIMEN 148 >gb|KHN11619.1| Putative calcium-binding protein CML45 [Glycine soja] Length = 207 Score = 97.8 bits (242), Expect = 5e-23 Identities = 49/75 (65%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+K+ F FD NKDGFID ELQRVLC LGLK LE C+ MIR FD N DG Sbjct: 133 QEPSLEEVKQAFDAFDENKDGFIDAKELQRVLCILGLKEAAELENCNKMIRIFDTNQDGR 192 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK+MEN C Sbjct: 193 IDFIEFVKIMENRFC 207 >ref|XP_008341587.1| PREDICTED: probable calcium-binding protein CML45 [Malus domestica] Length = 195 Score = 97.4 bits (241), Expect = 5e-23 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSL E+KE F VFD NKDGFID +LQRVLC LGLK LE+C MIR FD NGDG Sbjct: 121 KEPSLGEVKEAFNVFDENKDGFIDARDLQRVLCILGLKEGSKLEDCQKMIRSFDKNGDGR 180 Query: 122 IDFRDFVKLMENCLC 78 I+F +FVK+ME C Sbjct: 181 IEFNEFVKVMEASFC 195 >ref|XP_009781412.1| PREDICTED: probable calcium-binding protein CML45 [Nicotiana sylvestris] Length = 104 Score = 94.7 bits (234), Expect = 5e-23 Identities = 44/71 (61%), Positives = 55/71 (77%), Gaps = 2/71 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 E PSLEE+K+ F +FD +K+GFID ELQRVLCSLG+K C+LE+C M+ FD NGDG+ Sbjct: 26 ENPSLEEVKQVFDMFDEDKNGFIDAFELQRVLCSLGIKEGCDLEKCTRMVNAFDDNGDGV 85 Query: 122 IDFRDFVKLME 90 IDF +F K ME Sbjct: 86 IDFTEFAKFME 96 >ref|XP_012489589.1| PREDICTED: probable calcium-binding protein CML45 [Gossypium raimondii] gi|763773715|gb|KJB40838.1| hypothetical protein B456_007G079700 [Gossypium raimondii] Length = 197 Score = 97.1 bits (240), Expect = 7e-23 Identities = 47/75 (62%), Positives = 56/75 (74%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 EEPSL+E+KE F VFDVN+DGFID ELQRVLC LGLK ++ C+ MI FD N DG Sbjct: 123 EEPSLKELKEAFDVFDVNRDGFIDAQELQRVLCILGLKEGLKVDNCNKMIENFDENRDGR 182 Query: 122 IDFRDFVKLMENCLC 78 IDF++FVK ME+ C Sbjct: 183 IDFQEFVKFMEHSFC 197 >ref|XP_002323865.1| hypothetical protein POPTR_0017s12100g [Populus trichocarpa] gi|222866867|gb|EEF03998.1| hypothetical protein POPTR_0017s12100g [Populus trichocarpa] Length = 212 Score = 97.4 bits (241), Expect = 7e-23 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -1 Query: 296 EEPSLEEIKETFGVFDVNKDGFIDGSELQRVLCSLGLK--CNLEECDGMIRKFDGNGDGL 123 +EPSLEE+KE F VFD N+DGF+D SELQRV LGLK LE+C +IR FD NGDG Sbjct: 138 KEPSLEEVKEAFNVFDHNRDGFVDASELQRVFYKLGLKEGLQLEKCRKIIRTFDENGDGR 197 Query: 122 IDFRDFVKLMENCLC 78 IDF +FVK MEN C Sbjct: 198 IDFNEFVKFMENSFC 212