BLASTX nr result
ID: Rehmannia27_contig00054135
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00054135 (387 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP26215.1| hypothetical protein JCGZ_22461 [Jatropha curcas] 50 8e-06 >gb|KDP26215.1| hypothetical protein JCGZ_22461 [Jatropha curcas] Length = 92 Score = 50.4 bits (119), Expect = 8e-06 Identities = 27/57 (47%), Positives = 32/57 (56%) Frame = -1 Query: 330 MAGMQYYFFPTDFYYPRPPPINTTATAHHHQDPQIGAPKRPIHGEIDIDDGAHLNSA 160 MAG+QYYFFPTDF+YPRPPP +A+ I KR D +D LN A Sbjct: 1 MAGLQYYFFPTDFFYPRPPPTADRDSANKPPVVHIQTQKR------DKEDMEKLNKA 51