BLASTX nr result
ID: Rehmannia27_contig00053347
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00053347 (490 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF27380.1| conserved hypothetical protein [Ricinus communis] 56 2e-07 emb|CAN71471.1| hypothetical protein VITISV_038995 [Vitis vinifera] 56 2e-06 >gb|EEF27380.1| conserved hypothetical protein [Ricinus communis] Length = 125 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 175 RPMDSRVERTPMECLSLGGTPNIPEVPELSSLPKGA 68 RPM SRVER P++CLS GGTP PEV ELSSLPK A Sbjct: 49 RPMGSRVERIPIDCLSFGGTPLSPEVTELSSLPKRA 84 >emb|CAN71471.1| hypothetical protein VITISV_038995 [Vitis vinifera] Length = 324 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 175 RPMDSRVERTPMECLSLGGTPNIPEVPELSSLPKGA 68 RPM SRVER P++ LSLGGTP IPEV ELSSLPK A Sbjct: 207 RPMGSRVERIPIDFLSLGGTPLIPEVTELSSLPKRA 242