BLASTX nr result
ID: Rehmannia27_contig00051872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00051872 (413 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094007.1| PREDICTED: putative transcription factor bHL... 63 6e-09 ref|XP_011078203.1| PREDICTED: putative transcription factor bHL... 63 6e-09 emb|CDP03151.1| unnamed protein product [Coffea canephora] 59 2e-07 gb|EYU27320.1| hypothetical protein MIMGU_mgv1a026242mg [Erythra... 55 3e-06 ref|XP_015081845.1| PREDICTED: putative transcription factor bHL... 54 9e-06 >ref|XP_011094007.1| PREDICTED: putative transcription factor bHLH041 [Sesamum indicum] Length = 537 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 100 MDSIFVLGEADRAAFLQHMKQSFGCTYICLWSY 2 MDSIF+LGE +RAAFLQ M QSFGC YICLWSY Sbjct: 1 MDSIFLLGEGERAAFLQQMMQSFGCAYICLWSY 33 >ref|XP_011078203.1| PREDICTED: putative transcription factor bHLH041 [Sesamum indicum] Length = 543 Score = 62.8 bits (151), Expect = 6e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 100 MDSIFVLGEADRAAFLQHMKQSFGCTYICLWS 5 MDSIF+LG+A RAAFLQHM QSFGC+YICLWS Sbjct: 23 MDSIFLLGQAHRAAFLQHMTQSFGCSYICLWS 54 >emb|CDP03151.1| unnamed protein product [Coffea canephora] Length = 547 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 100 MDSIFVLGEADRAAFLQHMKQSFGCTYICLWSY 2 MDS+F LGE DRA FLQ++ QS GCTYICLWSY Sbjct: 1 MDSVFSLGEGDRAIFLQNLVQSSGCTYICLWSY 33 >gb|EYU27320.1| hypothetical protein MIMGU_mgv1a026242mg [Erythranthe guttata] Length = 516 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -2 Query: 100 MDSIFVLGEADRAAFLQHMKQSFGCTYICLWSY 2 MD++F+LGE DRAAFL+ M SFG Y+CLWSY Sbjct: 1 MDTVFLLGEGDRAAFLRQMMHSFGSVYVCLWSY 33 >ref|XP_015081845.1| PREDICTED: putative transcription factor bHLH041 [Solanum pennellii] Length = 515 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -2 Query: 100 MDSIFVLGEADRAAFLQHMKQSFGCTYICLWSY 2 MDSIF L E DRA FL + +SFGCTYICLW Y Sbjct: 1 MDSIFFLEEGDRAVFLLKIMESFGCTYICLWQY 33