BLASTX nr result
ID: Rehmannia27_contig00051226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00051226 (400 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091771.1| PREDICTED: F-box/WD-40 repeat-containing pro... 54 8e-06 ref|XP_011091770.1| PREDICTED: F-box/WD-40 repeat-containing pro... 54 8e-06 >ref|XP_011091771.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030 isoform X2 [Sesamum indicum] Length = 431 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = -2 Query: 399 VVGCEDGKVRVFDMYSRKISQIIKY----TSCLS 310 VVGCEDGKVRVFDMYSRKISQIIK SCLS Sbjct: 213 VVGCEDGKVRVFDMYSRKISQIIKMHPGAVSCLS 246 >ref|XP_011091770.1| PREDICTED: F-box/WD-40 repeat-containing protein At3g52030 isoform X1 [Sesamum indicum] Length = 432 Score = 53.5 bits (127), Expect = 8e-06 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 4/34 (11%) Frame = -2 Query: 399 VVGCEDGKVRVFDMYSRKISQIIKY----TSCLS 310 VVGCEDGKVRVFDMYSRKISQIIK SCLS Sbjct: 214 VVGCEDGKVRVFDMYSRKISQIIKMHPGAVSCLS 247