BLASTX nr result
ID: Rehmannia27_contig00050864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050864 (659 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014053722.1| PREDICTED: extensin-like [Salmo salar] 57 3e-06 >ref|XP_014053722.1| PREDICTED: extensin-like [Salmo salar] Length = 309 Score = 57.0 bits (136), Expect = 3e-06 Identities = 55/173 (31%), Positives = 74/173 (42%), Gaps = 3/173 (1%) Frame = -2 Query: 658 PYTPSKNDDTQKVPIP*SPTSIALPCNLRKS**PHQPS-HHDNTLPTNQYP*PTHCAQPQ 482 P+ P+ N P PT+ P + PH P+ +H PT+Q P PTH Sbjct: 94 PHPPTTNTS------PHPPTTNTSPHPPTTNTSPHPPTTNHQPPAPTHQPPGPTHQPPTP 147 Query: 481 LPIFNP-SQK*THQ*SWPAPLDTYTPIKPFCHINHKSNQLYPKTPQYIHPS*LQHPSKTP 305 PI P + THQ PAP + P P + H+ P T P H + P Sbjct: 148 APIHQPPTPAPTHQPPTPAPTHQHQP--PSTNHQHQP----PPTNHQHQPPPTNHQHQ-P 200 Query: 304 PPTQY*PAHKPFPI*SIYTP*HTIF*HQNPNTNSKHLDPCQK-QTTKPNL*PP 149 PPT + H+P P + P T HQ P+TN +H P Q+T P+ PP Sbjct: 201 PPTNH--QHQPPPTNYQHQPPSTNHQHQPPSTNHQHQPPSTNYQSTSPH--PP 249