BLASTX nr result
ID: Rehmannia27_contig00050795
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050795 (504 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38538.1| hypothetical protein MIMGU_mgv1a0139571mg, partia... 51 8e-06 >gb|EYU38538.1| hypothetical protein MIMGU_mgv1a0139571mg, partial [Erythranthe guttata] Length = 70 Score = 50.8 bits (120), Expect = 8e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +2 Query: 371 ITVFYGSSPGKDDYFLEATDNLGKVLVKKHIHLVYKGGNFGLMG 502 I VF GSS GK + EA LGKVLV ++I LVY GG+ GLMG Sbjct: 15 ICVFCGSSQGKKTSYQEAATELGKVLVSRNIDLVYGGGSIGLMG 58