BLASTX nr result
ID: Rehmannia27_contig00050745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050745 (470 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012227553.1| PREDICTED: annexin B9-like isoform X1 [Linep... 57 7e-07 >ref|XP_012227553.1| PREDICTED: annexin B9-like isoform X1 [Linepithema humile] gi|815813144|ref|XP_012227554.1| PREDICTED: annexin B9-like isoform X1 [Linepithema humile] Length = 540 Score = 57.4 bits (137), Expect = 7e-07 Identities = 34/88 (38%), Positives = 42/88 (47%), Gaps = 3/88 (3%) Frame = -3 Query: 468 QDTLPTQPPHHASDPQPSNWQKHTQPTQPAIHPIPSTNTPSQISTPSQMPLPETNP---N 298 Q PTQPP H P PSN HT P QP HP S TPS S P P + P N Sbjct: 61 QAPYPTQPPIHHQHPTPSNPPTHTYPPQPMPHPSQSMPTPSMPRPFSDQPAPSSYPQQQN 120 Query: 297 YHTLTQKQSLHNPLQTMRTNPPTPHQKD 214 Y+ Q+Q+ +NP + P Q++ Sbjct: 121 YNPYPQQQN-YNPYPQQQNYNTHPQQQN 147