BLASTX nr result
ID: Rehmannia27_contig00050728
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050728 (759 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078609.1| PREDICTED: methyl-CpG-binding domain-contain... 61 4e-15 ref|XP_011072655.1| PREDICTED: methyl-CpG-binding domain-contain... 60 2e-14 ref|XP_011078601.1| PREDICTED: methyl-CpG-binding domain-contain... 60 2e-14 ref|XP_010106952.1| Methyl-CpG-binding domain-containing protein... 55 3e-13 ref|XP_011094058.1| PREDICTED: methyl-CpG-binding domain-contain... 52 1e-12 ref|XP_010046889.1| PREDICTED: methyl-CpG-binding domain-contain... 52 2e-12 gb|EYU31792.1| hypothetical protein MIMGU_mgv1a022502mg, partial... 51 2e-12 ref|XP_012844143.1| PREDICTED: methyl-CpG-binding domain-contain... 51 2e-12 ref|XP_012853850.1| PREDICTED: methyl-CpG-binding domain-contain... 51 2e-12 gb|EYU23658.1| hypothetical protein MIMGU_mgv1a019204mg, partial... 51 2e-12 emb|CDP12523.1| unnamed protein product [Coffea canephora] 55 4e-12 gb|KCW78599.1| hypothetical protein EUGRSUZ_C00067 [Eucalyptus g... 52 4e-12 ref|XP_012850393.1| PREDICTED: methyl-CpG-binding domain-contain... 51 4e-12 gb|EYU26553.1| hypothetical protein MIMGU_mgv1a024860mg, partial... 51 4e-12 ref|XP_010259932.1| PREDICTED: methyl-CpG-binding domain-contain... 51 7e-12 ref|XP_012844173.1| PREDICTED: methyl-CpG-binding domain-contain... 53 1e-11 ref|XP_007014523.1| Methyl-CPG-binding domain protein 02, putati... 54 2e-11 ref|XP_007014522.1| Methyl-CPG-binding domain protein 02, putati... 54 2e-11 ref|XP_012444181.1| PREDICTED: methyl-CpG-binding domain-contain... 54 2e-11 gb|KHG22902.1| Methyl-CpG-binding domain-containing 2 -like prot... 54 2e-11 >ref|XP_011078609.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Sesamum indicum] gi|747064086|ref|XP_011078610.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Sesamum indicum] Length = 202 Score = 61.2 bits (147), Expect(2) = 4e-15 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 634 RPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 RP++SC+DE+DVKQDDSFLWAMD+ RI Q PGW Sbjct: 59 RPNVSCNDESDVKQDDSFLWAMDRPRIPQTPPGW 92 Score = 48.1 bits (113), Expect(2) = 4e-15 Identities = 29/64 (45%), Positives = 34/64 (53%), Gaps = 4/64 (6%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPYRG----NHQFRG*SQYS 364 +R LRIRAEG TKFA V YV P R RSMVE R + + +G F+ Sbjct: 93 QRILRIRAEGGTKFADVYYVTPSNKRLRSMVELSRYINEHPHLKGVNISQFSFQPPVPLD 152 Query: 363 EKYI 352 EKYI Sbjct: 153 EKYI 156 >ref|XP_011072655.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Sesamum indicum] Length = 216 Score = 60.5 bits (145), Expect(2) = 2e-14 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 634 RPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 RP +SC++E+DVKQDDSFLWAMDK RI Q PGW Sbjct: 59 RPSVSCNEESDVKQDDSFLWAMDKPRIPQTPPGW 92 Score = 46.2 bits (108), Expect(2) = 2e-14 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQD 415 +R LRIRAEG TKFA V YV P R RSMVE R + + Sbjct: 93 QRILRIRAEGGTKFADVYYVTPSNKRLRSMVELSRYINE 131 >ref|XP_011078601.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Sesamum indicum] gi|747064069|ref|XP_011078602.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Sesamum indicum] Length = 203 Score = 60.5 bits (145), Expect(2) = 2e-14 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 634 RPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 RP +SC++E+DVKQDDSFLWAMDK RI Q PGW Sbjct: 59 RPSVSCNEESDVKQDDSFLWAMDKPRIPQTPPGW 92 Score = 46.2 bits (108), Expect(2) = 2e-14 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQD 415 +R LRIRAEG TKFA V YV P R RSMVE R + + Sbjct: 93 QRILRIRAEGGTKFADVYYVTPSNKRLRSMVELSRYINE 131 >ref|XP_010106952.1| Methyl-CpG-binding domain-containing protein 2 [Morus notabilis] gi|587925573|gb|EXC12834.1| Methyl-CpG-binding domain-containing protein 2 [Morus notabilis] Length = 317 Score = 55.1 bits (131), Expect(2) = 3e-13 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD AD+ QD S LWA+DK I+Q PGW Sbjct: 136 EWRPDISCDDPADISQDGSRLWAIDKPNIAQPPPGW 171 Score = 47.8 bits (112), Expect(2) = 3e-13 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPYRGN 394 +R LRIR EGSTKFA V YVAP R RSMVE ++ + + Y N Sbjct: 172 QRLLRIRGEGSTKFADVYYVAPSGKRLRSMVEVQKYLLEHPEYVSN 217 >ref|XP_011094058.1| PREDICTED: methyl-CpG-binding domain-containing protein 2 [Sesamum indicum] Length = 369 Score = 52.0 bits (123), Expect(2) = 1e-12 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 173 EWRPDVSCDDPPDITQDGSRLWAIDKPSIAQPPPGW 208 Score = 48.9 bits (115), Expect(2) = 1e-12 Identities = 25/43 (58%), Positives = 29/43 (67%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA V YVAP R RSMVE +R + + Y Sbjct: 209 QRLLRIRGEGSTKFADVYYVAPSGKRLRSMVEIQRYINEHPEY 251 >ref|XP_010046889.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Eucalyptus grandis] gi|702288807|ref|XP_010046890.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Eucalyptus grandis] gi|629113925|gb|KCW78600.1| hypothetical protein EUGRSUZ_C00067 [Eucalyptus grandis] Length = 353 Score = 51.6 bits (122), Expect(2) = 2e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 153 EWRPEISCDDPEDISQDGSRLWAIDKPNIAQPPPGW 188 Score = 48.9 bits (115), Expect(2) = 2e-12 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPYRGN 394 +R LRIR EGSTKFA V YVAP R RSMVE ++ + D + G+ Sbjct: 189 QRLLRIRGEGSTKFADVYYVAPSGKRLRSMVEVQKYLVDHPEFTGD 234 >gb|EYU31792.1| hypothetical protein MIMGU_mgv1a022502mg, partial [Erythranthe guttata] Length = 188 Score = 50.8 bits (120), Expect(2) = 2e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SC DE+DVKQD + WAMD+ RI Q GW Sbjct: 62 EWRPEISCKDESDVKQDGTMRWAMDRPRIPQTPSGW 97 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIRAEG TKFA V YVAP R RSMVE R + + Y Sbjct: 98 QRILRIRAEGGTKFADVYYVAPSNKRLRSMVELHRYIDEHPEY 140 >ref|XP_012844143.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887846|ref|XP_012844144.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887848|ref|XP_012844145.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887850|ref|XP_012844146.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887853|ref|XP_012844147.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887855|ref|XP_012844148.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887857|ref|XP_012844149.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] gi|848887859|ref|XP_012844150.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] Length = 184 Score = 50.8 bits (120), Expect(2) = 2e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SC DE+DVKQD + WAMD+ RI Q GW Sbjct: 58 EWRPEISCKDESDVKQDGTMRWAMDRPRIPQTPSGW 93 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIRAEG TKFA V YVAP R RSMVE R + + Y Sbjct: 94 QRILRIRAEGGTKFADVYYVAPSNKRLRSMVELHRYIDEHPEY 136 >ref|XP_012853850.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] Length = 155 Score = 50.8 bits (120), Expect(2) = 2e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SC DE+DVKQD + WAMD+ RI Q GW Sbjct: 29 EWRPEISCKDESDVKQDGTMRWAMDRPRIPQTPSGW 64 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIRAEG TKFA V YVAP R RSMVE R + + Y Sbjct: 65 QRILRIRAEGGTKFADVYYVAPSNKRLRSMVELHRYIDEHPEY 107 >gb|EYU23658.1| hypothetical protein MIMGU_mgv1a019204mg, partial [Erythranthe guttata] Length = 129 Score = 50.8 bits (120), Expect(2) = 2e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SC DE+DVKQD + WAMD+ RI Q GW Sbjct: 23 EWRPEISCKDESDVKQDGTMRWAMDRPRIPQTPSGW 58 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIRAEG TKFA V YVAP R RSMVE R + + Y Sbjct: 59 QRILRIRAEGGTKFADVYYVAPSNKRLRSMVELHRYIDEHPEY 101 >emb|CDP12523.1| unnamed protein product [Coffea canephora] Length = 351 Score = 55.1 bits (131), Expect(2) = 4e-12 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDDE D++QD S LWA+DK I+Q PGW Sbjct: 164 EWRPDVSCDDEPDIEQDGSRLWAIDKPSIAQPPPGW 199 Score = 43.9 bits (102), Expect(2) = 4e-12 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA V Y +P R RSMVE + +++ Y Sbjct: 200 QRLLRIRGEGSTKFADVYYESPSGKRLRSMVEIHKYLEEHPEY 242 >gb|KCW78599.1| hypothetical protein EUGRSUZ_C00067 [Eucalyptus grandis] Length = 329 Score = 51.6 bits (122), Expect(2) = 4e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RP++SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 153 EWRPEISCDDPEDISQDGSRLWAIDKPNIAQPPPGW 188 Score = 47.4 bits (111), Expect(2) = 4e-12 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDS 412 +R LRIR EGSTKFA V YVAP R RSMVE ++ + D+ Sbjct: 189 QRLLRIRGEGSTKFADVYYVAPSGKRLRSMVEVQKPLHDN 228 >ref|XP_012850393.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] Length = 310 Score = 51.2 bits (121), Expect(2) = 4e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SC+D D+ QD S LWA+DK I+Q PGW Sbjct: 154 EWRPDISCEDAPDITQDGSRLWAIDKPNIAQPPPGW 189 Score = 47.8 bits (112), Expect(2) = 4e-12 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA V YVAP R RSMVE ++ + ++ Y Sbjct: 190 QRLLRIRGEGSTKFADVYYVAPTGKRLRSMVEVQKYLAENTKY 232 >gb|EYU26553.1| hypothetical protein MIMGU_mgv1a024860mg, partial [Erythranthe guttata] Length = 260 Score = 51.2 bits (121), Expect(2) = 4e-12 Identities = 21/36 (58%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SC+D D+ QD S LWA+DK I+Q PGW Sbjct: 142 EWRPDISCEDAPDITQDGSRLWAIDKPNIAQPPPGW 177 Score = 47.8 bits (112), Expect(2) = 4e-12 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA V YVAP R RSMVE ++ + ++ Y Sbjct: 178 QRLLRIRGEGSTKFADVYYVAPTGKRLRSMVEVQKYLAENTKY 220 >ref|XP_010259932.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Nelumbo nucifera] gi|720012662|ref|XP_010259933.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Nelumbo nucifera] Length = 358 Score = 51.2 bits (121), Expect(2) = 7e-12 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD AD+ QD S LWA+DK I+Q GW Sbjct: 151 EWRPDISCDDPADISQDGSRLWAIDKPNIAQPPLGW 186 Score = 47.0 bits (110), Expect(2) = 7e-12 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = -1 Query: 540 LDGKRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 L +R LRIR EGSTKFA V YV+P R RSMVE +R + + Y Sbjct: 184 LGWERLLRIRGEGSTKFADVYYVSPSGKRLRSMVEVQRYLLEHPEY 229 >ref|XP_012844173.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Erythranthe guttata] Length = 186 Score = 52.8 bits (125), Expect(2) = 1e-11 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SC DE+D+KQD + WAMDK RI Q GW Sbjct: 58 EWRPDVSCKDESDIKQDGTMRWAMDKPRIPQTPSGW 93 Score = 44.7 bits (104), Expect(2) = 1e-11 Identities = 23/43 (53%), Positives = 26/43 (60%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIRAEG T F V YVAP R RSMVE R + + Y Sbjct: 94 QRILRIRAEGGTTFFDVYYVAPSNKRMRSMVELSRYIDEHPEY 136 >ref|XP_007014523.1| Methyl-CPG-binding domain protein 02, putative isoform 2 [Theobroma cacao] gi|590582077|ref|XP_007014524.1| Methyl-CPG-binding domain protein 02, putative isoform 2 [Theobroma cacao] gi|508784886|gb|EOY32142.1| Methyl-CPG-binding domain protein 02, putative isoform 2 [Theobroma cacao] gi|508784887|gb|EOY32143.1| Methyl-CPG-binding domain protein 02, putative isoform 2 [Theobroma cacao] Length = 351 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 158 EWRPDISCDDPTDISQDGSRLWAIDKPNIAQPPPGW 193 Score = 43.5 bits (101), Expect(2) = 2e-11 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA + Y AP R RSMVE ++ + + Y Sbjct: 194 QRLLRIRGEGSTKFADIYYQAPSGKRLRSMVEVQKYLIEHPEY 236 >ref|XP_007014522.1| Methyl-CPG-binding domain protein 02, putative isoform 1 [Theobroma cacao] gi|508784885|gb|EOY32141.1| Methyl-CPG-binding domain protein 02, putative isoform 1 [Theobroma cacao] Length = 341 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 148 EWRPDISCDDPTDISQDGSRLWAIDKPNIAQPPPGW 183 Score = 43.5 bits (101), Expect(2) = 2e-11 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA + Y AP R RSMVE ++ + + Y Sbjct: 184 QRLLRIRGEGSTKFADIYYQAPSGKRLRSMVEVQKYLIEHPEY 226 >ref|XP_012444181.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|823222912|ref|XP_012444182.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|823222914|ref|XP_012444183.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|823222916|ref|XP_012444184.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|823222918|ref|XP_012444185.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|823222920|ref|XP_012444187.1| PREDICTED: methyl-CpG-binding domain-containing protein 2-like [Gossypium raimondii] gi|763786684|gb|KJB53680.1| hypothetical protein B456_009G001500 [Gossypium raimondii] gi|763786685|gb|KJB53681.1| hypothetical protein B456_009G001500 [Gossypium raimondii] gi|763786686|gb|KJB53682.1| hypothetical protein B456_009G001500 [Gossypium raimondii] gi|763786687|gb|KJB53683.1| hypothetical protein B456_009G001500 [Gossypium raimondii] gi|763786688|gb|KJB53684.1| hypothetical protein B456_009G001500 [Gossypium raimondii] gi|763786689|gb|KJB53685.1| hypothetical protein B456_009G001500 [Gossypium raimondii] Length = 340 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 149 EWRPDISCDDPTDISQDGSRLWAIDKPNIAQPPPGW 184 Score = 43.5 bits (101), Expect(2) = 2e-11 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA + Y AP R RSMVE ++ + + Y Sbjct: 185 QRLLRIRGEGSTKFADIYYQAPTGKRLRSMVEVQKYLIEHPEY 227 >gb|KHG22902.1| Methyl-CpG-binding domain-containing 2 -like protein [Gossypium arboreum] Length = 340 Score = 53.5 bits (127), Expect(2) = 2e-11 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 640 ECRPDLSCDDEADVKQDDSFLWAMDKSRISQMHPGW 533 E RPD+SCDD D+ QD S LWA+DK I+Q PGW Sbjct: 149 EWRPDISCDDPTDISQDGSRLWAIDKPNIAQPPPGW 184 Score = 43.5 bits (101), Expect(2) = 2e-11 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -1 Query: 531 KRTLRIRAEGSTKFAAVNYVAPPKMRFRSMVEQRRVVQDSDPY 403 +R LRIR EGSTKFA + Y AP R RSMVE ++ + + Y Sbjct: 185 QRLLRIRGEGSTKFADIYYQAPTGKRLRSMVEVQKYLIEHPEY 227