BLASTX nr result
ID: Rehmannia27_contig00050578
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050578 (364 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA13487.1| hypothetical protein SOVF_116540 [Spinacia oleracea] 154 1e-46 gb|KMS64820.1| hypothetical protein BVRB_042330 [Beta vulgaris s... 136 2e-39 gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkho... 131 5e-36 dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE6... 131 5e-36 dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE6... 131 7e-36 dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia mul... 130 2e-35 gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas tit... 126 6e-35 gb|EHL79825.1| hypothetical protein HMPREF1033_03203 [Tannerella... 117 2e-32 gb|EJZ61746.1| hypothetical protein HMPREF9448_02880 [Barnesiell... 119 1e-31 gb|EDN87535.1| hypothetical protein PARMER_01067 [Parabacteroide... 115 4e-31 gb|EJZ62527.1| hypothetical protein HMPREF9448_02443 [Barnesiell... 119 4e-31 emb|CRY95131.1| hypothetical protein [uncultured prokaryote] 114 3e-30 emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria mening... 114 9e-30 gb|EDS13664.1| hypothetical protein BACSTE_03848 [Bacteroides st... 108 4e-29 emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria mening... 112 5e-29 gb|EIJ67033.1| hypothetical protein BD31_I1797 [Candidatus Nitro... 112 5e-29 emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria mening... 112 7e-29 emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria mening... 110 6e-28 emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria mening... 110 6e-28 emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria mening... 110 6e-28 >gb|KNA13487.1| hypothetical protein SOVF_116540 [Spinacia oleracea] Length = 110 Score = 154 bits (389), Expect = 1e-46 Identities = 77/110 (70%), Positives = 89/110 (80%) Frame = +3 Query: 12 MALPYGTTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKL 191 MALPY TTGSLC +F P RLVGL+VK YAI L+ RLPSVL +PL+ASVT LEATTPVKL Sbjct: 1 MALPYRTTGSLCPSFDPVRLVGLTVKQAYAIALHVRLPSVLSLPLKASVTFLEATTPVKL 60 Query: 192 PTKQCPRLSQVRHQIIQGLYFKDD*STPSDAASKSPTYPTHQLPNINVKL 341 PTKQCPR S+VR++I +G YFK D TP +A S SP YPTH +PN+NVKL Sbjct: 61 PTKQCPRHSRVRNRIQKGRYFKVDSMTPGEATSTSPAYPTHPVPNLNVKL 110 >gb|KMS64820.1| hypothetical protein BVRB_042330 [Beta vulgaris subsp. vulgaris] Length = 129 Score = 136 bits (343), Expect = 2e-39 Identities = 70/104 (67%), Positives = 81/104 (77%) Frame = +3 Query: 30 TTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKLPTKQCP 209 TTGSL +F P RLVGL+VK YAI L RLPSVL +PL+ASVT LEATTPVKLPT QCP Sbjct: 26 TTGSLYPSFDPGRLVGLTVKQAYAIALPVRLPSVLSLPLKASVTFLEATTPVKLPTTQCP 85 Query: 210 RLSQVRHQIIQGLYFKDD*STPSDAASKSPTYPTHQLPNINVKL 341 S +R++I +G YFK D +TP +AASKSP YPTH +PN NVKL Sbjct: 86 PHSGIRNRIQKGRYFKVDSTTPGEAASKSPAYPTHPVPNFNVKL 129 >gb|KNH03717.1| Cell wall-associated hydrolase [Candidatus Burkholderia brachyanthoides] Length = 234 Score = 131 bits (330), Expect = 5e-36 Identities = 74/124 (59%), Positives = 84/124 (67%), Gaps = 3/124 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ STLMPLH H ++ YL PPL F RRPP Sbjct: 109 SVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLCTPPLRFGRRPP 168 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILHINYPISMLSYSKG 351 QSN P VPD RL+ + ++G ISRT RLA+ SL PILH + M SYSKG Sbjct: 169 QSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHKSVQNPMQSYSKG 228 Query: 352 SRGL 363 S GL Sbjct: 229 SWGL 232 >dbj|BAO87435.1| putative membrane protein [Burkholderia sp. RPE67] gi|636795462|dbj|BAO87487.1| putative membrane protein [Burkholderia sp. RPE67] gi|636795573|dbj|BAO87598.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 131 bits (330), Expect = 5e-36 Identities = 74/124 (59%), Positives = 84/124 (67%), Gaps = 3/124 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ STLMPLH H ++ YL PPL F RRPP Sbjct: 109 SVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLRFGRRPP 168 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILHINYPISMLSYSKG 351 QSN P VPD RL+ + ++G ISRT RLA+ SL PILH + M SYSKG Sbjct: 169 QSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPMQSYSKG 228 Query: 352 SRGL 363 S GL Sbjct: 229 SWGL 232 >dbj|BAO86772.1| putative membrane protein [Burkholderia sp. RPE67] gi|636796135|dbj|BAO88159.1| putative membrane protein [Burkholderia sp. RPE67] gi|636798863|dbj|BAO90886.1| putative membrane protein [Burkholderia sp. RPE67] Length = 234 Score = 131 bits (329), Expect = 7e-36 Identities = 74/124 (59%), Positives = 84/124 (67%), Gaps = 3/124 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ STLMPLH H ++ YL PPL F RRPP Sbjct: 109 SVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLHFGRRPP 168 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILHINYPISMLSYSKG 351 QSN P VPD RL+ + ++G ISRT RLA+ SL PILH + M SYSKG Sbjct: 169 QSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPRLASWFHSLPPILHRSVQSPMQSYSKG 228 Query: 352 SRGL 363 S GL Sbjct: 229 SWGL 232 >dbj|BAG46932.1| cell wall-associated hydrolase [Burkholderia multivorans ATCC 17616] Length = 234 Score = 130 bits (326), Expect = 2e-35 Identities = 73/124 (58%), Positives = 84/124 (67%), Gaps = 3/124 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ STLMPLH H ++ YL PPL F RRPP Sbjct: 109 SVERWPFHTEPPDHYDLLSHLLDLSVSQLSTLMPLHYQHDFRPYLAYLRTPPLPFGRRPP 168 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILHINYPISMLSYSKG 351 QSN P VPD RL+ + ++G ISRT +LA + SL PILH + M SYSKG Sbjct: 169 QSNCLPCTVPDPDHGPRLEPQTNQGGISRTAPPKLAFRFHSLPPILHRSVQSPMQSYSKG 228 Query: 352 SRGL 363 S GL Sbjct: 229 SWGL 232 >gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas titanicae BH1] Length = 163 Score = 126 bits (317), Expect = 6e-35 Identities = 73/124 (58%), Positives = 81/124 (65%), Gaps = 3/124 (2%) Frame = +2 Query: 2 PLSDGPSIRNHRITMLYFRT*STCRSLSQAPLCHYTLRTVTKRAEGTFGSLRYSFGGDHP 181 PLSDGPSI+NHRIT FRT STC S SQAPLC T T++ RAEGTF LRYS GGD P Sbjct: 24 PLSDGPSIQNHRITRTCFRTCSTCLSRSQAPLCSCTQCTMSDRAEGTFVLLRYSLGGDRP 83 Query: 182 SQTTHQAMSP---T*SG*TSDNPRVVFQGRLIYA*RRSLKVSNLSYTSITQYQC*AIVKV 352 SQTTH +S T +++ R+VFQG L R K S LSYT QC AIVKV Sbjct: 84 SQTTHHTLSSIRITDLSENANDARLVFQGWLPPNWRPEFKASQLSYTGNISVQCEAIVKV 143 Query: 353 HGVF 364 HGVF Sbjct: 144 HGVF 147 >gb|EHL79825.1| hypothetical protein HMPREF1033_03203 [Tannerella sp. 6_1_58FAA_CT1] Length = 81 Score = 117 bits (293), Expect = 2e-32 Identities = 59/69 (85%), Positives = 62/69 (89%) Frame = -1 Query: 208 GHCLVGSLTGVVASKRVTEASKGTLSTLGNRA*SVMA*GCLTERPTSRSGTKVEHSDPVV 29 GHCLVGSLTGVVASK VTEASKGTL +GNR SVMA GCLTERPTSRSG K+EHSDPVV Sbjct: 4 GHCLVGSLTGVVASKSVTEASKGTLRPIGNRPESVMAEGCLTERPTSRSGRKLEHSDPVV 63 Query: 28 PYGRAIAQR 2 P+GRAIAQR Sbjct: 64 PHGRAIAQR 72 >gb|EJZ61746.1| hypothetical protein HMPREF9448_02880 [Barnesiella intestinihominis YIT 11860] gi|404336940|gb|EJZ63398.1| hypothetical protein HMPREF9448_02055, partial [Barnesiella intestinihominis YIT 11860] gi|404338790|gb|EJZ65235.1| hypothetical protein HMPREF9448_00968 [Barnesiella intestinihominis YIT 11860] Length = 181 Score = 119 bits (297), Expect = 1e-31 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = +3 Query: 12 MALPYGTTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKL 191 MALP GTTGSLCS+F+PDRLVGLSVKHP AITL RLP LRVPLEASVTLLEATTPVKL Sbjct: 1 MALPCGTTGSLCSSFLPDRLVGLSVKHPCAITLSDRLPIGLRVPLEASVTLLEATTPVKL 60 Query: 192 PTKQCPRLSQV 224 PTKQCPR S++ Sbjct: 61 PTKQCPRYSEL 71 >gb|EDN87535.1| hypothetical protein PARMER_01067 [Parabacteroides merdae ATCC 43184] Length = 107 Score = 115 bits (287), Expect = 4e-31 Identities = 58/67 (86%), Positives = 60/67 (89%) Frame = +3 Query: 12 MALPYGTTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKL 191 MALP GTTGSLCS+F+PDRLV L VKHPYAITLY RLP LRVPLEASVTLLEATTPVKL Sbjct: 1 MALPCGTTGSLCSSFLPDRLVCLPVKHPYAITLYDRLPIGLRVPLEASVTLLEATTPVKL 60 Query: 192 PTKQCPR 212 PT QCPR Sbjct: 61 PTIQCPR 67 >gb|EJZ62527.1| hypothetical protein HMPREF9448_02443 [Barnesiella intestinihominis YIT 11860] Length = 236 Score = 119 bits (297), Expect = 4e-31 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = +3 Query: 12 MALPYGTTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKL 191 MALP GTTGSLCS+F+PDRLVGLSVKHP AITL RLP LRVPLEASVTLLEATTPVKL Sbjct: 1 MALPCGTTGSLCSSFLPDRLVGLSVKHPCAITLSDRLPIGLRVPLEASVTLLEATTPVKL 60 Query: 192 PTKQCPRLSQV 224 PTKQCPR S++ Sbjct: 61 PTKQCPRYSEL 71 >emb|CRY95131.1| hypothetical protein [uncultured prokaryote] Length = 154 Score = 114 bits (285), Expect = 3e-30 Identities = 66/124 (53%), Positives = 81/124 (65%), Gaps = 3/124 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFH+ PPDHY LLS+L++L +SQSSTL+PLH H ++ YL PPL F RRPP Sbjct: 29 SVERWPFHSVPPDHYDLLSHLLELWLSQSSTLLPLHYQHDFRPYLAYLRTPPLPFRRRPP 88 Query: 181 QSNYPPSNVPDLVR---LDIR*SKGCISRTTNLRLATQPQSLQPILHINYPISMLSYSKG 351 QSN P VP+ V L+ + ++G ISR+T LA L PILH + SM S SKG Sbjct: 89 QSNCLPCTVPNSVHLSWLEPQTNQGGISRSTPEELALLFLCLPPILHKSVHSSMQSCSKG 148 Query: 352 SRGL 363 S GL Sbjct: 149 SWGL 152 >emb|CWO70233.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990625706|emb|CWS61864.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 114 bits (286), Expect = 9e-30 Identities = 64/107 (59%), Positives = 73/107 (68%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 95 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 154 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VPD RL+ + +G ISRTT RLA+ QSL PILH Sbjct: 155 QSNCLPCTVPDPDDGSRLEPQRHQGGISRTTPQRLASLLQSLPPILH 201 >gb|EDS13664.1| hypothetical protein BACSTE_03848 [Bacteroides stercoris ATCC 43183] Length = 74 Score = 108 bits (271), Expect = 4e-29 Identities = 53/67 (79%), Positives = 57/67 (85%) Frame = +3 Query: 12 MALPYGTTGSLCSTFVPDRLVGLSVKHPYAITLYARLPSVLRVPLEASVTLLEATTPVKL 191 M+ PY TGSLCS+F+PDRLV L VK PYAITL RLP V+R PLEASVTLLEATTPVKL Sbjct: 1 MSFPYRNTGSLCSSFLPDRLVSLPVKRPYAITLCRRLPIVVRAPLEASVTLLEATTPVKL 60 Query: 192 PTKQCPR 212 PTKQCPR Sbjct: 61 PTKQCPR 67 >emb|CWM94285.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989313903|emb|CWQ55632.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989484098|emb|CWP70409.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989587849|emb|CWT55260.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989679941|emb|CWQ46117.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989699132|emb|CWQ13555.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989851433|emb|CWQ36002.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989859357|emb|CWM24872.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989866471|emb|CWM89367.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989880493|emb|CWM29376.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989913553|emb|CWM58488.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989929723|emb|CWQ43465.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990000040|emb|CWO88989.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990003565|emb|CWM95535.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990010278|emb|CWR30100.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990025700|emb|CWQ33640.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990053515|emb|CWQ59206.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990055668|emb|CWM36524.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990068245|emb|CWS69311.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990093958|emb|CWM22624.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990097941|emb|CWP71542.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990139421|emb|CWM59150.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990150376|emb|CWP51019.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990152413|emb|CWM08047.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990153519|emb|CWO07120.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990156638|emb|CWT61805.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990169354|emb|CWM47351.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990170795|emb|CWT94404.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990174940|emb|CWR12276.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990188814|emb|CWN35808.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990192458|emb|CWR65428.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990200332|emb|CWS39952.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990208038|emb|CWM58445.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990220020|emb|CWQ35548.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990222421|emb|CWR63221.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990226751|emb|CWQ50134.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990234371|emb|CWO61260.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990240754|emb|CWP84864.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990245230|emb|CWR81609.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990246549|emb|CWO15838.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990256312|emb|CWM62696.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990268959|emb|CWQ53410.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990273158|emb|CWQ41081.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990275165|emb|CWQ35446.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990276391|emb|CWR13064.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990283151|emb|CWR93195.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990314132|emb|CWR58618.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990315312|emb|CWN75830.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990321648|emb|CWN92984.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990330459|emb|CWN28987.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990332627|emb|CWN69271.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990334844|emb|CWM82912.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990337330|emb|CWR53819.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990338591|emb|CWP88866.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990343598|emb|CWM23382.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990353677|emb|CWM26625.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990372647|emb|CWQ19861.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990376713|emb|CWT62879.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990398714|emb|CWM53098.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990410698|emb|CWT53692.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990413855|emb|CWM83365.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990414543|emb|CWO21529.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990427109|emb|CWN92282.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990440856|emb|CWS58259.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990446478|emb|CWQ37187.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990456720|emb|CWS05620.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990498424|emb|CWS03273.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990518192|emb|CWR66185.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990542319|emb|CWQ77951.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990583487|emb|CWM54395.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990585765|emb|CWR31800.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990586515|emb|CWS23086.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990609420|emb|CWO96526.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990612854|emb|CWS82264.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990618385|emb|CWQ60516.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990630374|emb|CWO11803.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990632856|emb|CWO26530.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990644929|emb|CWP00554.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990653044|emb|CWS13977.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990655405|emb|CWQ30750.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990676061|emb|CWM62238.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990677644|emb|CWN86557.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990680753|emb|CWN54402.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990703322|emb|CWQ65336.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 112 bits (281), Expect = 5e-29 Identities = 63/107 (58%), Positives = 72/107 (67%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 95 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 154 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VPD RL+ + +G ISRT RLA+ QSL PILH Sbjct: 155 QSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILH 201 >gb|EIJ67033.1| hypothetical protein BD31_I1797 [Candidatus Nitrosopumilus salaria BD31] Length = 179 Score = 112 bits (279), Expect = 5e-29 Identities = 58/91 (63%), Positives = 67/91 (73%), Gaps = 3/91 (3%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQSS LMPLH + ++ GYL PPLLF RRPP Sbjct: 88 SVERWPFHTEPPDHYDLLSHLLDLSVSQSSNLMPLHYQYDFRPYLGYLRTPPLLFGRRPP 147 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTT 264 QSN PP VPD RL+ + +G ISR+T Sbjct: 148 QSNCPPYTVPDPDYGPRLEPQQHQGGISRST 178 >emb|CWP67249.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989546979|emb|CWT59615.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989768582|emb|CWS18382.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989832193|emb|CWR45378.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989917941|emb|CWQ16501.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990044742|emb|CWN87478.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990065852|emb|CWM92680.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990129147|emb|CWN67326.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990146256|emb|CWP45878.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990160737|emb|CWP38468.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990177712|emb|CWQ30366.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990213921|emb|CWO45593.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990238664|emb|CWT45368.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990260105|emb|CWM35122.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990266648|emb|CWQ61517.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990269997|emb|CWR11989.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990296094|emb|CWT68492.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990360023|emb|CWP89907.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990383000|emb|CWM28216.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990449487|emb|CWQ55809.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990483526|emb|CWM90768.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990494058|emb|CWQ97896.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990506858|emb|CWS39350.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990510153|emb|CWO06049.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990548391|emb|CWN51672.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990551238|emb|CWM72155.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990567658|emb|CWO27120.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990597715|emb|CWN29951.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990600283|emb|CWQ78977.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990636945|emb|CWQ62225.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990657955|emb|CWS89623.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990685141|emb|CWM32710.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 216 Score = 112 bits (281), Expect = 7e-29 Identities = 63/107 (58%), Positives = 72/107 (67%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 109 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 168 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VPD RL+ + +G ISRT RLA+ QSL PILH Sbjct: 169 QSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLQSLPPILH 215 >emb|CWS15795.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 110 bits (274), Expect = 6e-28 Identities = 62/107 (57%), Positives = 71/107 (66%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 95 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 154 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VPD RL+ + +G ISRT RLA+ SL PILH Sbjct: 155 QSNCLPCTVPDPDDGSRLEPQRHQGGISRTAPQRLASLLLSLPPILH 201 >emb|CWT82569.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989194423|emb|CWP44468.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989287025|emb|CWT59196.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989301711|emb|CWS83033.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989372899|emb|CWP46906.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989521533|emb|CWP27798.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989749570|emb|CWN98251.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989854743|emb|CWQ04956.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989884247|emb|CWT93866.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989892101|emb|CWP96790.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989964443|emb|CWT92957.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990108210|emb|CWR69071.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990141188|emb|CWN70881.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990180320|emb|CWN17584.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990237357|emb|CWQ42038.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990615270|emb|CWP73355.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990628609|emb|CWO79925.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990656741|emb|CWR78282.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990670556|emb|CWS37293.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|990681813|emb|CWO16958.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 110 bits (274), Expect = 6e-28 Identities = 62/107 (57%), Positives = 71/107 (66%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 95 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 154 Query: 181 QSNYPPSNVPDL---VRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VPD L+ + +G ISRT RLA+ QSL PILH Sbjct: 155 QSNCLPCTVPDPDDGSGLEPQRHQGGISRTAPQRLASLLQSLPPILH 201 >emb|CWT43744.1| Cell wall-associated hydrolase [Neisseria meningitidis] gi|989157672|emb|CWQ03425.1| Cell wall-associated hydrolase [Neisseria meningitidis] Length = 202 Score = 110 bits (274), Expect = 6e-28 Identities = 62/107 (57%), Positives = 71/107 (66%), Gaps = 3/107 (2%) Frame = +1 Query: 1 SFERWPFHTEPPDHYALLSYLIDLSVSQSSTLMPLHSTHGYQAC*GYLWKPPLLFWRRPP 180 S ERWPFHTEPPDHY LLS+L+DLSVSQ S L+PLH ++ G L PPL F RRPP Sbjct: 95 SVERWPFHTEPPDHYVLLSHLLDLSVSQLSYLLPLHYQSDFRPDLGNLRTPPLRFGRRPP 154 Query: 181 QSNYPPSNVP---DLVRLDIR*SKGCISRTTNLRLATQPQSLQPILH 312 QSN P VP D L+ + +G ISRT RLA+ QSL PILH Sbjct: 155 QSNCLPCTVPDPDDESGLEPQRHQGGISRTAPQRLASLLQSLPPILH 201