BLASTX nr result
ID: Rehmannia27_contig00050517
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00050517 (500 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP29111.1| hypothetical protein JCGZ_16500 [Jatropha curcas] 52 7e-06 >gb|KDP29111.1| hypothetical protein JCGZ_16500 [Jatropha curcas] Length = 121 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 177 MAKQVGLLSSWIEVAPALFIFPEKPSNPPRLET 275 MAKQ+ L SWIEVAPAL I+P+KPSN P LET Sbjct: 1 MAKQLASLYSWIEVAPALIIYPQKPSNSPSLET 33