BLASTX nr result
ID: Rehmannia27_contig00049847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049847 (430 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077354.1| PREDICTED: syntaxin-71 isoform X1 [Sesamum i... 71 3e-12 ref|XP_011094682.1| PREDICTED: syntaxin-71-like [Sesamum indicum] 70 8e-12 ref|XP_011048568.1| PREDICTED: syntaxin-71-like [Populus euphrat... 70 8e-12 ref|XP_010543383.1| PREDICTED: syntaxin-71 isoform X1 [Tarenaya ... 70 8e-12 ref|XP_002280272.1| PREDICTED: syntaxin-71 [Vitis vinifera] gi|2... 70 8e-12 ref|XP_002519551.1| PREDICTED: syntaxin-71 [Ricinus communis] gi... 70 8e-12 gb|EPS69140.1| hypothetical protein M569_05627, partial [Genlise... 66 2e-11 emb|CDP06727.1| unnamed protein product [Coffea canephora] 69 2e-11 ref|XP_009778698.1| PREDICTED: syntaxin-71-like [Nicotiana sylve... 69 2e-11 ref|XP_009612370.1| PREDICTED: syntaxin-71-like [Nicotiana tomen... 69 2e-11 ref|XP_009405715.1| PREDICTED: syntaxin-71-like [Musa acuminata ... 69 2e-11 gb|ADE77137.1| unknown [Picea sitchensis] 69 2e-11 ref|XP_010924474.1| PREDICTED: syntaxin-71-like isoform X2 [Elae... 69 3e-11 ref|XP_010924473.1| PREDICTED: syntaxin-71-like isoform X1 [Elae... 69 4e-11 ref|XP_011004623.1| PREDICTED: syntaxin-71-like [Populus euphrat... 68 4e-11 ref|XP_011004621.1| PREDICTED: syntaxin-71-like [Populus euphrat... 68 4e-11 ref|XP_002322868.1| Syntaxin 73 family protein [Populus trichoca... 68 4e-11 ref|XP_006381472.1| Syntaxin 73 family protein [Populus trichoca... 68 4e-11 ref|XP_008795484.1| PREDICTED: syntaxin-71-like isoform X2 [Phoe... 67 4e-11 ref|XP_007027295.1| Syntaxin of plants 71 [Theobroma cacao] gi|5... 68 4e-11 >ref|XP_011077354.1| PREDICTED: syntaxin-71 isoform X1 [Sesamum indicum] Length = 265 Score = 71.2 bits (173), Expect = 3e-12 Identities = 39/58 (67%), Positives = 41/58 (70%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNFXXXXXXXXXXXXXXXXXYNVLRR 256 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF YNVLR+ Sbjct: 208 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNFCIDIILLCIILGIAAYLYNVLRK 265 >ref|XP_011094682.1| PREDICTED: syntaxin-71-like [Sesamum indicum] Length = 264 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF Sbjct: 207 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNF 241 >ref|XP_011048568.1| PREDICTED: syntaxin-71-like [Populus euphratica] Length = 265 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_010543383.1| PREDICTED: syntaxin-71 isoform X1 [Tarenaya hassleriana] gi|729350877|ref|XP_010543385.1| PREDICTED: syntaxin-71 isoform X2 [Tarenaya hassleriana] Length = 265 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_002280272.1| PREDICTED: syntaxin-71 [Vitis vinifera] gi|297741579|emb|CBI32711.3| unnamed protein product [Vitis vinifera] Length = 265 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_002519551.1| PREDICTED: syntaxin-71 [Ricinus communis] gi|223541414|gb|EEF42965.1| syntaxin, putative [Ricinus communis] Length = 266 Score = 70.1 bits (170), Expect = 8e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLKDTVN+LRSSRNF Sbjct: 209 MDEIDTKVDKATADLKNTNVRLKDTVNQLRSSRNF 243 >gb|EPS69140.1| hypothetical protein M569_05627, partial [Genlisea aurea] Length = 118 Score = 66.2 bits (160), Expect = 2e-11 Identities = 36/58 (62%), Positives = 40/58 (68%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNFXXXXXXXXXXXXXXXXXYNVLRR 256 +DEIDTKVDKAT+DLKNTNVRLKDTV +LRSSRNF YNVLR+ Sbjct: 61 VDEIDTKVDKATSDLKNTNVRLKDTVTQLRSSRNFCIDIVLLCVILGIAAYLYNVLRK 118 >emb|CDP06727.1| unnamed protein product [Coffea canephora] Length = 262 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKAT+DLKNTNVRLKDTVN+LRSSRNF Sbjct: 205 MDEIDTKVDKATSDLKNTNVRLKDTVNQLRSSRNF 239 >ref|XP_009778698.1| PREDICTED: syntaxin-71-like [Nicotiana sylvestris] Length = 265 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKAT+DLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKATSDLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_009612370.1| PREDICTED: syntaxin-71-like [Nicotiana tomentosiformis] Length = 265 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKAT+DLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKATSDLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_009405715.1| PREDICTED: syntaxin-71-like [Musa acuminata subsp. malaccensis] Length = 267 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKAT+DLKNTNVRLKDTVN+LRSSRNF Sbjct: 210 MDEIDTKVDKATSDLKNTNVRLKDTVNQLRSSRNF 244 >gb|ADE77137.1| unknown [Picea sitchensis] Length = 267 Score = 68.9 bits (167), Expect = 2e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 +DEIDTKVDKAT+DLKNTNVRLKDTVNKLRSSRNF Sbjct: 210 IDEIDTKVDKATSDLKNTNVRLKDTVNKLRSSRNF 244 >ref|XP_010924474.1| PREDICTED: syntaxin-71-like isoform X2 [Elaeis guineensis] Length = 267 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLK+TVN+LRSSRNF Sbjct: 210 MDEIDTKVDKATADLKNTNVRLKETVNQLRSSRNF 244 >ref|XP_010924473.1| PREDICTED: syntaxin-71-like isoform X1 [Elaeis guineensis] Length = 294 Score = 68.6 bits (166), Expect = 4e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKATADLKNTNVRLK+TVN+LRSSRNF Sbjct: 237 MDEIDTKVDKATADLKNTNVRLKETVNQLRSSRNF 271 >ref|XP_011004623.1| PREDICTED: syntaxin-71-like [Populus euphratica] Length = 264 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKA ADLKNTNVRLKDTVN+LRSSRNF Sbjct: 207 MDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNF 241 >ref|XP_011004621.1| PREDICTED: syntaxin-71-like [Populus euphratica] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKA ADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_002322868.1| Syntaxin 73 family protein [Populus trichocarpa] gi|222867498|gb|EEF04629.1| Syntaxin 73 family protein [Populus trichocarpa] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKA ADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_006381472.1| Syntaxin 73 family protein [Populus trichocarpa] gi|550336175|gb|ERP59269.1| Syntaxin 73 family protein [Populus trichocarpa] Length = 265 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKA ADLKNTNVRLKDTVN+LRSSRNF Sbjct: 208 MDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNF 242 >ref|XP_008795484.1| PREDICTED: syntaxin-71-like isoform X2 [Phoenix dactylifera] Length = 212 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVD+ATADLKNTNVRLK+TVN+LRSSRNF Sbjct: 155 MDEIDTKVDRATADLKNTNVRLKETVNQLRSSRNF 189 >ref|XP_007027295.1| Syntaxin of plants 71 [Theobroma cacao] gi|508715900|gb|EOY07797.1| Syntaxin of plants 71 [Theobroma cacao] Length = 267 Score = 68.2 bits (165), Expect = 4e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 429 MDEIDTKVDKATADLKNTNVRLKDTVNKLRSSRNF 325 MDEIDTKVDKA ADLKNTNVRLKDTVN+LRSSRNF Sbjct: 210 MDEIDTKVDKAAADLKNTNVRLKDTVNQLRSSRNF 244