BLASTX nr result
ID: Rehmannia27_contig00049224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049224 (680 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH45523.1| hypothetical protein GLYMA_08G276700 [Glycine max] 57 2e-07 >gb|KRH45523.1| hypothetical protein GLYMA_08G276700 [Glycine max] Length = 121 Score = 57.4 bits (137), Expect = 2e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 491 SKVNVAAEVIYHLVDPRPNLIFGAVIDPSLSDQDV 595 S+VN AAEVIY LVDP NLIFGAVIDPSLS QD+ Sbjct: 78 SEVNTAAEVIYDLVDPTANLIFGAVIDPSLSGQDI 112