BLASTX nr result
ID: Rehmannia27_contig00049070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00049070 (785 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098677.1| PREDICTED: probable serine/threonine-protein... 67 5e-09 >ref|XP_011098677.1| PREDICTED: probable serine/threonine-protein kinase At1g54610 [Sesamum indicum] Length = 690 Score = 66.6 bits (161), Expect = 5e-09 Identities = 38/60 (63%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = -2 Query: 184 MGCVSSKKARSQSPAFDGVVXXXXXXXXXXXXR-LVSSGPLHVQAALGPLAKIKEEPEKE 8 MGCVSSKKARSQSPAFD V L SSG +HVQAALG L KIKEEPE+E Sbjct: 1 MGCVSSKKARSQSPAFDDVSSCSASAGRSSRPGRLASSGSVHVQAALGSLEKIKEEPERE 60