BLASTX nr result
ID: Rehmannia27_contig00048626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00048626 (1008 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072902.1| PREDICTED: cysteine desulfurase 2, chloropla... 59 4e-06 ref|XP_011072901.1| PREDICTED: cysteine desulfurase 2, chloropla... 59 5e-06 >ref|XP_011072902.1| PREDICTED: cysteine desulfurase 2, chloroplastic isoform X2 [Sesamum indicum] Length = 411 Score = 58.5 bits (140), Expect = 4e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 916 SSSAASVLPIDQIVSWAHDVGAKVLVDACQS 1008 S+ ASVLPIDQIVSWAHDVGAKVLVDACQS Sbjct: 225 SNVLASVLPIDQIVSWAHDVGAKVLVDACQS 255 >ref|XP_011072901.1| PREDICTED: cysteine desulfurase 2, chloroplastic isoform X1 [Sesamum indicum] Length = 465 Score = 58.5 bits (140), Expect = 5e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 916 SSSAASVLPIDQIVSWAHDVGAKVLVDACQS 1008 S+ ASVLPIDQIVSWAHDVGAKVLVDACQS Sbjct: 225 SNVLASVLPIDQIVSWAHDVGAKVLVDACQS 255