BLASTX nr result
ID: Rehmannia27_contig00048569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00048569 (424 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32153.1| hypothetical protein MIMGU_mgv1a000520mg [Erythra... 58 3e-07 ref|XP_012843764.1| PREDICTED: RAB6A-GEF complex partner protein... 58 3e-07 ref|XP_011092768.1| PREDICTED: RAB6A-GEF complex partner protein... 58 3e-07 ref|XP_012843763.1| PREDICTED: RAB6A-GEF complex partner protein... 58 3e-07 gb|KNA19833.1| hypothetical protein SOVF_057850 [Spinacia oleracea] 56 2e-06 ref|XP_015056029.1| PREDICTED: RAB6A-GEF complex partner protein... 56 2e-06 ref|XP_006339611.1| PREDICTED: RAB6A-GEF complex partner protein... 56 2e-06 ref|XP_009621942.1| PREDICTED: protein RIC1 homolog [Nicotiana t... 56 2e-06 ref|XP_009800597.1| PREDICTED: protein RIC1 homolog [Nicotiana s... 56 2e-06 ref|XP_010934365.1| PREDICTED: RAB6A-GEF complex partner protein... 55 3e-06 ref|XP_008785301.1| PREDICTED: protein RIC1 homolog [Phoenix dac... 55 3e-06 ref|XP_010055098.1| PREDICTED: protein RIC1 homolog [Eucalyptus ... 55 3e-06 ref|XP_010934364.1| PREDICTED: RAB6A-GEF complex partner protein... 55 3e-06 emb|CAN81454.1| hypothetical protein VITISV_010293 [Vitis vinifera] 55 5e-06 emb|CBI40433.3| unnamed protein product [Vitis vinifera] 55 5e-06 ref|XP_010326569.1| PREDICTED: RAB6A-GEF complex partner protein... 55 5e-06 ref|XP_003633961.1| PREDICTED: RAB6A-GEF complex partner protein... 55 5e-06 ref|XP_009387773.1| PREDICTED: protein RIC1 homolog [Musa acumin... 55 5e-06 ref|XP_011465753.1| PREDICTED: RAB6A-GEF complex partner protein... 55 5e-06 ref|XP_008350019.1| PREDICTED: protein RIC1 homolog [Malus domes... 54 5e-06 >gb|EYU32153.1| hypothetical protein MIMGU_mgv1a000520mg [Erythranthe guttata] Length = 1098 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE TN Sbjct: 877 LRLLQATLDESLYELAGELVRFLLRSGREYEPTN 910 >ref|XP_012843764.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 [Erythranthe guttata] Length = 1126 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE TN Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEPTN 938 >ref|XP_011092768.1| PREDICTED: RAB6A-GEF complex partner protein 1 [Sesamum indicum] Length = 1126 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE TN Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEPTN 938 >ref|XP_012843763.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 [Erythranthe guttata] Length = 1127 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE TN Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEPTN 938 >gb|KNA19833.1| hypothetical protein SOVF_057850 [Spinacia oleracea] Length = 1117 Score = 55.8 bits (133), Expect = 2e-06 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -2 Query: 156 VCYLL*DIFIN--AIHSDKDLSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 VCY+L + A+ L ++ ATLD+SLYELAGELVRFLLRSGREYE T Sbjct: 878 VCYILVIAKLEGPAVSQYCALRLLQATLDDSLYELAGELVRFLLRSGREYEQT 930 >ref|XP_015056029.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Solanum pennellii] Length = 1125 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 L ++ ATLDESLYELAGELVRFLLRSGREYE T Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEPT 937 >ref|XP_006339611.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Solanum tuberosum] Length = 1125 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 L ++ ATLDESLYELAGELVRFLLRSGREYE T Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEPT 937 >ref|XP_009621942.1| PREDICTED: protein RIC1 homolog [Nicotiana tomentosiformis] Length = 1129 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 L ++ ATLDESLYELAGELVRFLLRSGREYE T Sbjct: 909 LRLLQATLDESLYELAGELVRFLLRSGREYEPT 941 >ref|XP_009800597.1| PREDICTED: protein RIC1 homolog [Nicotiana sylvestris] Length = 1130 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 L ++ ATLDESLYELAGELVRFLLRSGREYE T Sbjct: 910 LRLLQATLDESLYELAGELVRFLLRSGREYEPT 942 >ref|XP_010934365.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 [Elaeis guineensis] Length = 1120 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE+ + Sbjct: 889 LRLLQATLDESLYELAGELVRFLLRSGREYENAS 922 >ref|XP_008785301.1| PREDICTED: protein RIC1 homolog [Phoenix dactylifera] Length = 1120 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE+ + Sbjct: 889 LRLLQATLDESLYELAGELVRFLLRSGREYENAS 922 >ref|XP_010055098.1| PREDICTED: protein RIC1 homolog [Eucalyptus grandis] gi|629106428|gb|KCW71574.1| hypothetical protein EUGRSUZ_E00109 [Eucalyptus grandis] Length = 1127 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 123 AIHSDKDLSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 A+ L ++ ATLDESLYELAGELVRFLLRSGREYE + Sbjct: 898 AVSQYSALRLLQATLDESLYELAGELVRFLLRSGREYEQAS 938 >ref|XP_010934364.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 [Elaeis guineensis] Length = 1149 Score = 55.1 bits (131), Expect = 3e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE+ + Sbjct: 918 LRLLQATLDESLYELAGELVRFLLRSGREYENAS 951 >emb|CAN81454.1| hypothetical protein VITISV_010293 [Vitis vinifera] Length = 1122 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE + Sbjct: 901 LRLLQATLDESLYELAGELVRFLLRSGREYEQAS 934 >emb|CBI40433.3| unnamed protein product [Vitis vinifera] Length = 1124 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE + Sbjct: 903 LRLLQATLDESLYELAGELVRFLLRSGREYEQAS 936 >ref|XP_010326569.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 [Solanum lycopersicum] Length = 1125 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYEST 4 L ++ ATLDESLYELAGELVRFLLRSGR+YE T Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGRDYEPT 937 >ref|XP_003633961.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 [Vitis vinifera] Length = 1126 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE + Sbjct: 905 LRLLQATLDESLYELAGELVRFLLRSGREYEQAS 938 >ref|XP_009387773.1| PREDICTED: protein RIC1 homolog [Musa acuminata subsp. malaccensis] Length = 1132 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYES 7 L ++ ATLDESLYELAGELVRFLLRSGREYE+ Sbjct: 899 LRLLQATLDESLYELAGELVRFLLRSGREYEN 930 >ref|XP_011465753.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Fragaria vesca subsp. vesca] Length = 1205 Score = 54.7 bits (130), Expect = 5e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYESTN 1 L ++ ATLDESLYELAGELVRFLLRSGREYE + Sbjct: 982 LRLLQATLDESLYELAGELVRFLLRSGREYEQAS 1015 >ref|XP_008350019.1| PREDICTED: protein RIC1 homolog [Malus domestica] Length = 436 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 102 LSIV*ATLDESLYELAGELVRFLLRSGREYE 10 L ++ ATLDESLYELAGELVRFLLRSGREYE Sbjct: 362 LRLLQATLDESLYELAGELVRFLLRSGREYE 392