BLASTX nr result
ID: Rehmannia27_contig00047577
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00047577 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090362.1| PREDICTED: fatty acyl-CoA reductase 3-like [... 64 1e-08 gb|EYU36082.1| hypothetical protein MIMGU_mgv1a004946mg [Erythra... 60 3e-07 ref|XP_012838541.1| PREDICTED: fatty acyl-CoA reductase 1-like [... 60 3e-07 >ref|XP_011090362.1| PREDICTED: fatty acyl-CoA reductase 3-like [Sesamum indicum] Length = 495 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 628 DSKGKPIRIGKPTTLNTMASFHNYIAIHYLPFLK 527 D++GKPIR+G+PTTL+TMASFHNYIA HYLP LK Sbjct: 368 DTRGKPIRVGQPTTLSTMASFHNYIATHYLPLLK 401 >gb|EYU36082.1| hypothetical protein MIMGU_mgv1a004946mg [Erythranthe guttata] Length = 503 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 625 SKGKPIRIGKPTTLNTMASFHNYIAIHYLPFLK 527 S GKPIR+G+P TLN+M+SFHNYI+ HYLPFLK Sbjct: 374 STGKPIRVGQPITLNSMSSFHNYISTHYLPFLK 406 >ref|XP_012838541.1| PREDICTED: fatty acyl-CoA reductase 1-like [Erythranthe guttata] Length = 511 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 625 SKGKPIRIGKPTTLNTMASFHNYIAIHYLPFLK 527 S GKPIR+G+P TLN+M+SFHNYI+ HYLPFLK Sbjct: 382 STGKPIRVGQPITLNSMSSFHNYISTHYLPFLK 414