BLASTX nr result
ID: Rehmannia27_contig00045292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00045292 (385 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008776155.1| PREDICTED: Golgi apparatus membrane protein-... 65 2e-11 gb|EJS82305.1| hypothetical protein GB112_03965, partial [Strept... 62 1e-10 ref|XP_010911560.1| PREDICTED: Golgi apparatus membrane protein-... 64 1e-10 gb|KVI01565.1| Protein of unknown function DUF846, eukaryotic [C... 65 1e-10 gb|AHH02365.1| putative ECHIDNA-like protein, partial [Aegiceras... 62 2e-10 ref|XP_009798024.1| PREDICTED: Golgi apparatus membrane protein-... 63 6e-10 ref|XP_009619212.1| PREDICTED: Golgi apparatus membrane protein-... 63 6e-10 ref|XP_012835899.1| PREDICTED: Golgi apparatus membrane protein-... 63 6e-10 ref|XP_006347294.1| PREDICTED: Golgi apparatus membrane protein-... 63 6e-10 ref|XP_004241411.1| PREDICTED: Golgi apparatus membrane protein-... 63 6e-10 gb|KRG90496.1| hypothetical protein GLYMA_20G094600 [Glycine max] 62 9e-10 ref|XP_012082952.1| PREDICTED: Golgi apparatus membrane protein-... 63 9e-10 ref|XP_010276498.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 gb|KYP71317.1| putative FAM18-like protein At1g09330 family [Caj... 62 1e-09 ref|XP_015939626.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 ref|XP_010092953.1| Protein ECHIDNA [Morus notabilis] gi|5878632... 62 1e-09 ref|XP_011092177.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 ref|XP_010938191.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 ref|XP_009416485.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 ref|XP_008781182.1| PREDICTED: Golgi apparatus membrane protein-... 62 1e-09 >ref|XP_008776155.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Phoenix dactylifera] Length = 119 Score = 65.5 bits (158), Expect = 2e-11 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVS 86 ECLDQESLARMNKKDSWLFWWTLYLTVS Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLTVS 114 >gb|EJS82305.1| hypothetical protein GB112_03965, partial [Streptococcus agalactiae GB00112] Length = 66 Score = 62.4 bits (150), Expect = 1e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVS 86 ECLDQESLARMNKKDSWLFWWTLYL V+ Sbjct: 35 ECLDQESLARMNKKDSWLFWWTLYLAVT 62 >ref|XP_010911560.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Elaeis guineensis] Length = 134 Score = 63.9 bits (154), Expect = 1e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVS 86 ECLDQESLAR+NKKDSWLFWWTLYLTVS Sbjct: 87 ECLDQESLARVNKKDSWLFWWTLYLTVS 114 >gb|KVI01565.1| Protein of unknown function DUF846, eukaryotic [Cynara cardunculus var. scolymus] Length = 219 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVS 86 ECLDQESLARMNKKDSWLFWWTLYLTVS Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLTVS 114 >gb|AHH02365.1| putative ECHIDNA-like protein, partial [Aegiceras corniculatum] Length = 88 Score = 62.4 bits (150), Expect = 2e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 63 ECLDQESLARMNKKDSWLFWWTLYLT 88 >ref|XP_009798024.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Nicotiana sylvestris] Length = 183 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVSNQFWF*IY 110 ECLDQES+ARMNKKDSWLFWWTLYLT F+ I+ Sbjct: 87 ECLDQESMARMNKKDSWLFWWTLYLTAVAWFFLAIF 122 >ref|XP_009619212.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Nicotiana tomentosiformis] Length = 183 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVSNQFWF*IY 110 ECLDQES+ARMNKKDSWLFWWTLYLT F+ I+ Sbjct: 87 ECLDQESMARMNKKDSWLFWWTLYLTAVAWFFLAIF 122 >ref|XP_012835899.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Erythranthe guttata] gi|604334322|gb|EYU38406.1| hypothetical protein MIMGU_mgv1a014641mg [Erythranthe guttata] Length = 183 Score = 63.2 bits (152), Expect = 6e-10 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVSNQFWF*IY 110 ECLDQESLARMNKKDSWLFWWTLYLT +F I+ Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLTAVVWVFFAIF 122 >ref|XP_006347294.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Solanum tuberosum] Length = 183 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVSNQFWF*IY 110 ECLDQES+ARMNKKDSWLFWWTLYLT F+ I+ Sbjct: 87 ECLDQESMARMNKKDSWLFWWTLYLTAVAWFFLAIF 122 >ref|XP_004241411.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Solanum lycopersicum] gi|970037806|ref|XP_015080235.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Solanum pennellii] Length = 183 Score = 63.2 bits (152), Expect = 6e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVSNQFWF*IY 110 ECLDQES+ARMNKKDSWLFWWTLYLT F+ I+ Sbjct: 87 ECLDQESMARMNKKDSWLFWWTLYLTAVAWFFLAIF 122 >gb|KRG90496.1| hypothetical protein GLYMA_20G094600 [Glycine max] Length = 145 Score = 62.0 bits (149), Expect = 9e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTV 83 ECLD ESLARMNKKDSWLFWWTLYLTV Sbjct: 118 ECLDHESLARMNKKDSWLFWWTLYLTV 144 >ref|XP_012082952.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Jatropha curcas] gi|643716672|gb|KDP28298.1| hypothetical protein JCGZ_14069 [Jatropha curcas] Length = 183 Score = 62.8 bits (151), Expect = 9e-10 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLTVS 86 ECLDQESLARMNKKDSWLFWWTLYLT + Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLTAA 114 >ref|XP_010276498.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA isoform X3 [Nelumbo nucifera] Length = 182 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 86 ECLDQESLARMNKKDSWLFWWTLYLT 111 >gb|KYP71317.1| putative FAM18-like protein At1g09330 family [Cajanus cajan] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_015939626.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA isoform X2 [Arachis duranensis] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_010092953.1| Protein ECHIDNA [Morus notabilis] gi|587863232|gb|EXB53006.1| Protein ECHIDNA [Morus notabilis] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_011092177.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Sesamum indicum] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_010938191.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Elaeis guineensis] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_009416485.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA isoform X2 [Musa acuminata subsp. malaccensis] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112 >ref|XP_008781182.1| PREDICTED: Golgi apparatus membrane protein-like protein ECHIDNA [Phoenix dactylifera] Length = 183 Score = 62.4 bits (150), Expect = 1e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +3 Query: 3 ECLDQESLARMNKKDSWLFWWTLYLT 80 ECLDQESLARMNKKDSWLFWWTLYLT Sbjct: 87 ECLDQESLARMNKKDSWLFWWTLYLT 112