BLASTX nr result
ID: Rehmannia27_contig00045130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00045130 (748 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW81887.1| hypothetical protein EUGRSUZ_C032521, partial [Eu... 61 2e-08 gb|KDO65103.1| hypothetical protein CISIN_1g032447mg [Citrus sin... 61 3e-08 ref|XP_010685337.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 63 3e-08 ref|XP_009621404.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 61 6e-08 gb|KDO73588.1| hypothetical protein CISIN_1g025377mg [Citrus sin... 61 8e-08 ref|XP_013465877.1| PHD finger alfin-like protein [Medicago trun... 61 8e-08 gb|KJB07068.1| hypothetical protein B456_001G021300 [Gossypium r... 61 9e-08 gb|KVI03378.1| Protein of unknown function DUF3594 [Cynara cardu... 58 9e-08 emb|CDP20538.1| unnamed protein product [Coffea canephora] 61 1e-07 gb|AFK41077.1| unknown [Lotus japonicus] 61 1e-07 gb|AFK38161.1| unknown [Lotus japonicus] 61 1e-07 ref|XP_004144207.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 i... 61 1e-07 gb|KJB07067.1| hypothetical protein B456_001G021300 [Gossypium r... 61 1e-07 ref|XP_009769684.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 61 1e-07 ref|XP_006338123.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 61 1e-07 ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 61 1e-07 ref|XP_004239609.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 61 1e-07 ref|XP_011093779.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 61 1e-07 gb|KJB70087.1| hypothetical protein B456_011G057500 [Gossypium r... 61 1e-07 gb|EPS64435.1| hypothetical protein M569_10345 [Genlisea aurea] 61 1e-07 >gb|KCW81887.1| hypothetical protein EUGRSUZ_C032521, partial [Eucalyptus grandis] Length = 121 Score = 60.8 bits (146), Expect = 2e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >gb|KDO65103.1| hypothetical protein CISIN_1g032447mg [Citrus sinensis] Length = 140 Score = 60.8 bits (146), Expect = 3e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 42 CDPEKENLCLYGFPSEQWEVNLPAEEV 68 >ref|XP_010685337.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Beta vulgaris subsp. vulgaris] gi|870852969|gb|KMT04850.1| hypothetical protein BVRB_7g170200 [Beta vulgaris subsp. vulgaris] Length = 249 Score = 62.8 bits (151), Expect = 3e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +3 Query: 645 NIYRVMLCIPEKENLCLYGFPSEQWEVNLPAEEV 746 N Y+ LC PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 36 NFYQ--LCDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_009621404.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Nicotiana tomentosiformis] Length = 188 Score = 60.8 bits (146), Expect = 6e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >gb|KDO73588.1| hypothetical protein CISIN_1g025377mg [Citrus sinensis] Length = 200 Score = 60.8 bits (146), Expect = 8e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_013465877.1| PHD finger alfin-like protein [Medicago truncatula] gi|657400818|gb|KEH39912.1| PHD finger alfin-like protein [Medicago truncatula] Length = 206 Score = 60.8 bits (146), Expect = 8e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 42 CDPEKENLCLYGFPSEQWEVNLPAEEV 68 >gb|KJB07068.1| hypothetical protein B456_001G021300 [Gossypium raimondii] Length = 212 Score = 60.8 bits (146), Expect = 9e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 38 CDPEKENLCLYGFPSEQWEVNLPAEEV 64 >gb|KVI03378.1| Protein of unknown function DUF3594 [Cynara cardunculus var. scolymus] Length = 94 Score = 58.2 bits (139), Expect = 9e-08 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C+ EKENLCLYGFPSEQWEVN PAEEV Sbjct: 15 CLQEKENLCLYGFPSEQWEVNFPAEEV 41 >emb|CDP20538.1| unnamed protein product [Coffea canephora] Length = 248 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 663 LCIPEKENLCLYGFPSEQWEVNLPAEEV 746 LC PEKENLCLYGFP+EQWEVNLPAEEV Sbjct: 41 LCDPEKENLCLYGFPNEQWEVNLPAEEV 68 >gb|AFK41077.1| unknown [Lotus japonicus] Length = 248 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 663 LCIPEKENLCLYGFPSEQWEVNLPAEEV 746 LC PEKENLCLYGFP+EQWEVNLPAEEV Sbjct: 41 LCNPEKENLCLYGFPNEQWEVNLPAEEV 68 >gb|AFK38161.1| unknown [Lotus japonicus] Length = 248 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 663 LCIPEKENLCLYGFPSEQWEVNLPAEEV 746 LC PEKENLCLYGFP+EQWEVNLPAEEV Sbjct: 41 LCNPEKENLCLYGFPNEQWEVNLPAEEV 68 >ref|XP_004144207.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 isoform X2 [Cucumis sativus] Length = 234 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >gb|KJB07067.1| hypothetical protein B456_001G021300 [Gossypium raimondii] gi|763739570|gb|KJB07069.1| hypothetical protein B456_001G021300 [Gossypium raimondii] Length = 236 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 38 CDPEKENLCLYGFPSEQWEVNLPAEEV 64 >ref|XP_009769684.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Nicotiana sylvestris] Length = 245 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_006338123.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Solanum tuberosum] Length = 245 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nicotiana sylvestris] Length = 246 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_004239609.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Solanum lycopersicum] gi|970026503|ref|XP_015074562.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Solanum pennellii] Length = 246 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 41 CDPEKENLCLYGFPSEQWEVNLPAEEV 67 >ref|XP_011093779.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Sesamum indicum] Length = 247 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 42 CDPEKENLCLYGFPSEQWEVNLPAEEV 68 >gb|KJB70087.1| hypothetical protein B456_011G057500 [Gossypium raimondii] Length = 249 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 42 CDPEKENLCLYGFPSEQWEVNLPAEEV 68 >gb|EPS64435.1| hypothetical protein M569_10345 [Genlisea aurea] Length = 249 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +3 Query: 666 CIPEKENLCLYGFPSEQWEVNLPAEEV 746 C PEKENLCLYGFPSEQWEVNLPAEEV Sbjct: 39 CDPEKENLCLYGFPSEQWEVNLPAEEV 65