BLASTX nr result
ID: Rehmannia27_contig00044457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044457 (435 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087997.1| PREDICTED: protein trichome birefringence-li... 60 4e-08 gb|EYU25600.1| hypothetical protein MIMGU_mgv1a025758mg, partial... 52 5e-06 >ref|XP_011087997.1| PREDICTED: protein trichome birefringence-like 12 [Sesamum indicum] Length = 404 Score = 60.5 bits (145), Expect = 4e-08 Identities = 35/49 (71%), Positives = 35/49 (71%) Frame = +1 Query: 289 MLMASKLTPKLITWLILPSCLLIFFYSXXXXXXXXXXXXGSPTSKIPLL 435 MLMASKLTPKLIT LILPSCLLIFFYS SPTSKIPLL Sbjct: 1 MLMASKLTPKLITSLILPSCLLIFFYSRLLPLYTTPSPQ-SPTSKIPLL 48 >gb|EYU25600.1| hypothetical protein MIMGU_mgv1a025758mg, partial [Erythranthe guttata] Length = 112 Score = 52.0 bits (123), Expect = 5e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 292 LMASKLTPKLITWLILPSCLLIFFYS 369 + +SKLTPKLITWLILPSCLLIFFYS Sbjct: 1 MASSKLTPKLITWLILPSCLLIFFYS 26