BLASTX nr result
ID: Rehmannia27_contig00044320
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044320 (2155 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095761.1| hypothetical protein L484_017568 [Morus nota... 60 8e-06 >ref|XP_010095761.1| hypothetical protein L484_017568 [Morus notabilis] gi|587872973|gb|EXB62181.1| hypothetical protein L484_017568 [Morus notabilis] Length = 1098 Score = 60.5 bits (145), Expect = 8e-06 Identities = 29/55 (52%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = -1 Query: 175 FVLEFLRETRMFGCNLVDTPMDPTTKTRP*YLTDSACVNRGRYQRLMGNL-FISH 14 +VL+ L+ET M GC LVDTPMDP TK P T+ V++G+YQRL+G L +++H Sbjct: 126 YVLDLLKETGMIGCRLVDTPMDPNTKLMP--RTEEMAVDKGQYQRLVGKLIYLTH 178