BLASTX nr result
ID: Rehmannia27_contig00044257
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044257 (489 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] 57 7e-07 >gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 57.4 bits (137), Expect = 7e-07 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 1/115 (0%) Frame = -3 Query: 349 DYIPEQYRKIIRGMINFVIYLHTQSLSLIDSPLDAITHFVVVGDIVKFSKINFQSATEQS 170 +Y+P +YRK+I+ M+ FV+ +H S + + V+ ++VKF K+ F +A+ S Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTAGF---GMPNIVIKNEVVKFWKVQFITASMGS 167 Query: 169 RRRDFQLICEVIRRDVLGNRAVTTLPIDMAHLVQKLVN-YQEWDEYVLNLFFSIL 8 + DF + V+ G + + LP +M H + L++ Q DEY+++ +I+ Sbjct: 168 KNNDFICLHRVVESLFSGEQHL-HLPREMQHFLDLLISGTQSEDEYLISRHVAIM 221