BLASTX nr result
ID: Rehmannia27_contig00044128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044128 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythra... 53 7e-06 >gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata] Length = 898 Score = 53.1 bits (126), Expect = 7e-06 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +2 Query: 140 QFVSVARSVIGKIYSILP-LSRFRLLRVWNATDTNYKSNSYGDSNDERHPRADIFQLVNL 316 Q V +ARS+ + +LP L RLLRV A DT++ NSYG + + D+FQLVN Sbjct: 541 QSVPLARSLCFEFEGVLPSLDHCRLLRVLRAADTDF--NSYGKNTHCTYTLEDVFQLVNS 598 Query: 317 RYLAIWIFWYKN 352 RYLA+ F Y+N Sbjct: 599 RYLAVDDFRYEN 610