BLASTX nr result
ID: Rehmannia27_contig00044122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00044122 (594 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086578.1| PREDICTED: glutathione transferase GST 23-li... 62 1e-08 >ref|XP_011086578.1| PREDICTED: glutathione transferase GST 23-like [Sesamum indicum] Length = 222 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 DDPVIKECWPPRDKMIEKFKAMREPYLEKVA 95 DDPVIKE WPPRDKM+EKFKAMREPYL++ A Sbjct: 192 DDPVIKEFWPPRDKMVEKFKAMREPYLQRTA 222