BLASTX nr result
ID: Rehmannia27_contig00043981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00043981 (433 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089952.1| PREDICTED: serine carboxypeptidase-like [Ses... 57 1e-06 ref|XP_012838015.1| PREDICTED: serine carboxypeptidase-like [Ery... 56 2e-06 gb|EYU37039.1| hypothetical protein MIMGU_mgv1a025090mg [Erythra... 55 3e-06 >ref|XP_011089952.1| PREDICTED: serine carboxypeptidase-like [Sesamum indicum] Length = 510 Score = 56.6 bits (135), Expect = 1e-06 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 308 AETKD-DXXXXXXXXXKYPKTQAEKLIRALNLFPKHEVNHHAG 433 AETKD D ++P+TQAE+LIRALNLFPK+EVNHHAG Sbjct: 27 AETKDGDSLSMSDSSLEFPRTQAERLIRALNLFPKNEVNHHAG 69 >ref|XP_012838015.1| PREDICTED: serine carboxypeptidase-like [Erythranthe guttata] Length = 508 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +2 Query: 353 KYPKTQAEKLIRALNLFPKHEVNHHAG 433 ++PKTQAEK IRALNLFPKHEVNHHAG Sbjct: 43 RFPKTQAEKQIRALNLFPKHEVNHHAG 69 >gb|EYU37039.1| hypothetical protein MIMGU_mgv1a025090mg [Erythranthe guttata] Length = 485 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 356 YPKTQAEKLIRALNLFPKHEVNHHAG 433 +PKTQAEK IRALNLFPKHEVNHHAG Sbjct: 30 FPKTQAEKQIRALNLFPKHEVNHHAG 55