BLASTX nr result
ID: Rehmannia27_contig00043811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00043811 (599 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088779.1| PREDICTED: thioredoxin-like protein CDSP32, ... 108 4e-25 ref|XP_012836764.1| PREDICTED: thioredoxin-like protein CDSP32, ... 85 3e-16 >ref|XP_011088779.1| PREDICTED: thioredoxin-like protein CDSP32, chloroplastic [Sesamum indicum] Length = 319 Score = 108 bits (270), Expect = 4e-25 Identities = 63/119 (52%), Positives = 81/119 (68%), Gaps = 14/119 (11%) Frame = -1 Query: 317 NESISSYNFTYSHPLISIKTRVSSLKLQANDQSSYLVKNKDALN--------------CS 180 N+S S + T+S PL S KTR SSLKLQ NDQ +LVK++D L+ C+ Sbjct: 21 NDSYSISSQTFSRPLNS-KTRASSLKLQPNDQGFWLVKDRDNLDFAKTETGEKILEIHCT 79 Query: 179 EEYDKEIQFSPEKLVIAHFSATHYKHNSKIQRFMEEQFIRLSNHIKFLYVMANESEQTR 3 EYDK +Q S EKLVIAHFSA HYK+N IQRFMEE+ R+S+ + FL+VMAN++E+ R Sbjct: 80 SEYDKGLQLSQEKLVIAHFSARHYKYNLIIQRFMEER-CRISSDVNFLHVMANDTEKIR 137 >ref|XP_012836764.1| PREDICTED: thioredoxin-like protein CDSP32, chloroplastic [Erythranthe guttata] gi|604333632|gb|EYU37983.1| hypothetical protein MIMGU_mgv1a010139mg [Erythranthe guttata] Length = 321 Score = 84.7 bits (208), Expect = 3e-16 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 7/112 (6%) Frame = -1 Query: 320 QNESISSYNFTYSHPLISIKTRV-SSLKLQAN-DQSSYLVKNK----DALNCSEEYDKEI 159 QN+SISS T+SHPL++ T + SSL +Q D + +K ++ EEYD E+ Sbjct: 19 QNKSISSSR-TFSHPLVTKATTLTSSLDIQVKVDNPGFKFMDKGEKVQQIHSIEEYDSEL 77 Query: 158 QFSPE-KLVIAHFSATHYKHNSKIQRFMEEQFIRLSNHIKFLYVMANESEQT 6 Q S KLV+AHFSATHYK+ +Q+FMEEQ +S IKFL+VMANES++T Sbjct: 78 QSSSHGKLVVAHFSATHYKYKILMQQFMEEQ-CSISKDIKFLHVMANESDKT 128