BLASTX nr result
ID: Rehmannia27_contig00043358
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00043358 (367 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837768.1| PREDICTED: charged multivesicular body prote... 52 4e-06 >ref|XP_012837768.1| PREDICTED: charged multivesicular body protein 5-like [Erythranthe guttata] gi|848874460|ref|XP_012837769.1| PREDICTED: charged multivesicular body protein 5-like [Erythranthe guttata] gi|848874462|ref|XP_012837770.1| PREDICTED: charged multivesicular body protein 5-like [Erythranthe guttata] gi|604332624|gb|EYU37223.1| hypothetical protein MIMGU_mgv1a016183mg [Erythranthe guttata] Length = 131 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +1 Query: 4 VKDAQQTRPMGQSSRLVTRSLFCNVLGTCCLPP 102 VKDA+Q R + +SSRL LFCNVLGTCCLPP Sbjct: 99 VKDAEQKRRIEESSRLARPGLFCNVLGTCCLPP 131