BLASTX nr result
ID: Rehmannia27_contig00043149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00043149 (420 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA48018.1| cell wall-associated hydrolase, partial [Vibrio c... 85 2e-19 gb|ABU69281.1| hypothetical protein VIBHAR_00248 [Vibrio campbel... 85 3e-19 gb|EJH45206.1| cell wall-associated hydrolase [Vibrio cholerae C... 85 3e-19 gb|KNH48635.1| cell wall-associated hydrolase, partial [Vibrio c... 85 6e-19 gb|KNA58906.1| cell wall-associated hydrolase, partial [Vibrio c... 85 6e-19 gb|KNH50143.1| cell wall-associated hydrolase, partial [Vibrio c... 85 9e-19 gb|EGR05231.1| cell wall-associated hydrolase [Vibrio cholerae H... 85 1e-18 gb|KNH56572.1| cell wall-associated hydrolase, partial [Vibrio c... 85 1e-18 gb|ELT25191.1| cell wall-associated hydrolase [Vibrio cholerae H... 85 1e-18 gb|EGR04180.1| cell wall-associated hydrolase [Vibrio cholerae H... 85 1e-18 gb|EGQ97970.1| cell wall-associated hydrolase [Vibrio cholerae H... 85 1e-18 gb|EGQ96299.1| cell wall-associated hydrolase [Vibrio cholerae H... 85 1e-18 gb|EFO37759.1| cell wall-associated hydrolase [Vibrio parahaemol... 84 2e-18 gb|EFO52251.1| cell wall-associated hydrolase [Vibrio parahaemol... 84 2e-18 gb|EFO51271.1| cell wall-associated hydrolase [Vibrio parahaemol... 84 3e-18 gb|EDL68006.1| cell wall-associated hydrolase [Vibrio campbellii... 84 6e-18 gb|EEW06587.1| conserved hypothetical protein [Vibrio mimicus VM... 84 6e-18 gb|ADT85291.1| Cell wall-associated hydrolase [Vibrio furnissii ... 84 6e-18 gb|EDL66891.1| cell wall-associated hydrolase [Vibrio campbellii... 84 7e-18 gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus ... 82 2e-17 >gb|KNA48018.1| cell wall-associated hydrolase, partial [Vibrio cholerae V51] Length = 77 Score = 85.1 bits (209), Expect = 2e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|ABU69281.1| hypothetical protein VIBHAR_00248 [Vibrio campbellii ATCC BAA-1116] Length = 79 Score = 85.1 bits (209), Expect = 3e-19 Identities = 44/69 (63%), Positives = 51/69 (73%), Gaps = 2/69 (2%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS--VKPHG 157 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS KP Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVSRRSKPSS 60 Query: 156 QLVLVSLTH 130 + L + +H Sbjct: 61 RTTLNANSH 69 >gb|EJH45206.1| cell wall-associated hydrolase [Vibrio cholerae CP1046(19)] Length = 79 Score = 85.1 bits (209), Expect = 3e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|KNH48635.1| cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 107 Score = 85.1 bits (209), Expect = 6e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|KNA58906.1| cell wall-associated hydrolase, partial [Vibrio cholerae 2740-80] gi|910943105|gb|KNH48972.1| cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 111 Score = 85.1 bits (209), Expect = 6e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|KNH50143.1| cell wall-associated hydrolase, partial [Vibrio cholerae V52] Length = 124 Score = 85.1 bits (209), Expect = 9e-19 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EGR05231.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] Length = 142 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|KNH56572.1| cell wall-associated hydrolase, partial [Vibrio cholerae 1587] Length = 144 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|ELT25191.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] Length = 144 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLAAQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EGR04180.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] Length = 144 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EGQ97970.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] Length = 144 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EGQ96299.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] gi|340035568|gb|EGQ96548.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] gi|340041127|gb|EGR02094.1| cell wall-associated hydrolase [Vibrio cholerae HE39] gi|340041352|gb|EGR02318.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] gi|340042065|gb|EGR03030.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] gi|340043751|gb|EGR04708.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] gi|340044272|gb|EGR05224.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] gi|340045380|gb|EGR06323.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] gi|340045735|gb|EGR06675.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] gi|340045743|gb|EGR06682.1| cell wall-associated hydrolase [Vibrio cholerae HCUF01] gi|340045937|gb|EGR06873.1| cell wall-associated hydrolase [Vibrio cholerae HC-49A2] gi|340047515|gb|EGR08438.1| cell wall-associated hydrolase [Vibrio cholerae HE48] gi|340048153|gb|EGR09075.1| cell wall-associated hydrolase [Vibrio cholerae HE48] gi|340048533|gb|EGR09451.1| cell wall-associated hydrolase [Vibrio cholerae HE48] gi|340049662|gb|EGR10575.1| cell wall-associated hydrolase [Vibrio cholerae HE48] gi|356451367|gb|EHI04054.1| cell wall-associated hydrolase [Vibrio cholerae HC-61A1] gi|395917038|gb|EJH27867.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395921242|gb|EJH32062.1| cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] gi|395922600|gb|EJH33416.1| cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] gi|395922858|gb|EJH33672.1| cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] gi|395922985|gb|EJH33798.1| cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] gi|395923337|gb|EJH34148.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395924084|gb|EJH34893.1| cell wall-associated hydrolase [Vibrio cholerae CP1032(5)] gi|395925500|gb|EJH36297.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395925949|gb|EJH36741.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395926230|gb|EJH37018.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395926405|gb|EJH37188.1| cell wall-associated hydrolase [Vibrio cholerae CP1038(11)] gi|395928231|gb|EJH38994.1| cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] gi|395931350|gb|EJH42095.1| cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] gi|395933064|gb|EJH43806.1| cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] gi|395935902|gb|EJH46636.1| cell wall-associated hydrolase [Vibrio cholerae CP1042(15)] gi|395936272|gb|EJH46998.1| cell wall-associated hydrolase [Vibrio cholerae CP1046(19)] gi|395936291|gb|EJH47016.1| cell wall-associated hydrolase [Vibrio cholerae CP1046(19)] gi|395938049|gb|EJH48747.1| cell wall-associated hydrolase [Vibrio cholerae CP1048(21)] gi|395954369|gb|EJH64979.1| cell wall-associated hydrolase [Vibrio cholerae HE-25] gi|395955393|gb|EJH65992.1| cell wall-associated hydrolase [Vibrio cholerae HE-45] gi|408648401|gb|EKL19741.1| cell wall-associated hydrolase family protein [Vibrio cholerae HC-61A2] gi|443456821|gb|ELT24219.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] gi|443458516|gb|ELT25911.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] gi|443459954|gb|ELT27345.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] gi|443459961|gb|ELT27351.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] gi|443460110|gb|ELT27499.1| cell wall-associated hydrolase [Vibrio cholerae HC-7A1] gi|443465651|gb|ELT40310.1| cell wall-associated hydrolase [Vibrio cholerae HC-81A1] gi|443466495|gb|ELT41152.1| cell wall-associated hydrolase [Vibrio cholerae HC-81A1] gi|443467679|gb|ELT42334.1| cell wall-associated hydrolase [Vibrio cholerae HC-81A1] gi|903096278|emb|CSC65776.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903101052|emb|CSC45210.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903123015|emb|CSD16164.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903141375|emb|CSC57916.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903176388|emb|CSB16218.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903180792|emb|CSC86490.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903202712|emb|CSA58297.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903213197|emb|CSA81106.1| Cell wall-associated hydrolase [Vibrio cholerae] gi|903306852|emb|CSD11689.1| Cell wall-associated hydrolase [Vibrio cholerae] Length = 144 Score = 85.1 bits (209), Expect = 1e-18 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSALI+S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSALINSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EFO37759.1| cell wall-associated hydrolase [Vibrio parahaemolyticus Peru-466] Length = 95 Score = 83.6 bits (205), Expect = 2e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EFO52251.1| cell wall-associated hydrolase [Vibrio parahaemolyticus K5030] Length = 111 Score = 83.6 bits (205), Expect = 2e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EFO51271.1| cell wall-associated hydrolase [Vibrio parahaemolyticus K5030] Length = 120 Score = 83.6 bits (205), Expect = 3e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EDL68006.1| cell wall-associated hydrolase [Vibrio campbellii HY01] gi|148869633|gb|EDL68619.1| cell wall-associated hydrolase [Vibrio campbellii HY01] gi|149746528|gb|EDM57517.1| cell wall-associated hydrolase [Vibrio parahaemolyticus AQ3810] gi|149746843|gb|EDM57831.1| cell wall-associated hydrolase [Vibrio parahaemolyticus AQ3810] gi|156524155|gb|ABU69241.1| hypothetical protein VIBHAR_00194 [Vibrio campbellii ATCC BAA-1116] gi|156524157|gb|ABU69243.1| hypothetical protein VIBHAR_00200 [Vibrio campbellii ATCC BAA-1116] gi|156524266|gb|ABU69352.1| hypothetical protein VIBHAR_00327 [Vibrio campbellii ATCC BAA-1116] gi|156524395|gb|ABU69481.1| hypothetical protein VIBHAR_00471 [Vibrio campbellii ATCC BAA-1116] gi|156527445|gb|ABU72531.1| hypothetical protein VIBHAR_03613 [Vibrio campbellii ATCC BAA-1116] gi|156527544|gb|ABU72630.1| hypothetical protein VIBHAR_03718 [Vibrio campbellii ATCC BAA-1116] gi|219547614|gb|EED24664.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219547982|gb|EED25005.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219548254|gb|EED25268.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219548329|gb|EED25341.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219548786|gb|EED25788.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219548881|gb|EED25881.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|219549776|gb|EED26765.1| cell wall-associated hydrolase [Vibrio sp. 16] gi|308087217|gb|EFO36912.1| cell wall-associated hydrolase [Vibrio parahaemolyticus Peru-466] gi|308088010|gb|EFO37705.1| cell wall-associated hydrolase [Vibrio parahaemolyticus Peru-466] gi|308109567|gb|EFO47107.1| cell wall-associated hydrolase [Vibrio parahaemolyticus AQ4037] gi|532611388|gb|EQM45162.1| hypothetical protein D042_3233 [Vibrio parahaemolyticus NIHCB0757] gi|532616850|gb|EQM50448.1| cell wall-associated hydrolase domain protein [Vibrio parahaemolyticus VPCR-2010] gi|532617004|gb|EQM50590.1| hypothetical protein D051_5813 [Vibrio parahaemolyticus VPCR-2010] Length = 144 Score = 83.6 bits (205), Expect = 6e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EEW06587.1| conserved hypothetical protein [Vibrio mimicus VM603] Length = 144 Score = 83.6 bits (205), Expect = 6e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|ADT85291.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315178575|gb|ADT85489.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315178673|gb|ADT85587.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315178792|gb|ADT85706.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315179086|gb|ADT86000.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315179295|gb|ADT86209.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] gi|315181320|gb|ADT88234.1| Cell wall-associated hydrolase [Vibrio furnissii NCTC 11218] Length = 144 Score = 83.6 bits (205), Expect = 6e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EDL66891.1| cell wall-associated hydrolase [Vibrio campbellii HY01] Length = 150 Score = 83.6 bits (205), Expect = 7e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 MLSA+I S SYRA+ LA QPEHQR+VH GPLVLG P N+PTPTADRDRTVS Sbjct: 1 MLSAVIDSELSYRAMRLATQPEHQRFVHSGPLVLGAAPFNLPTPTADRDRTVS 53 >gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260151029|gb|EEW86125.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|260924847|gb|EEX91415.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261295337|gb|EEX98833.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|261295369|gb|EEX98865.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261303002|gb|EEY06499.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|262551237|gb|EEZ07328.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|264663252|gb|EEZ33513.1| cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 82.4 bits (202), Expect = 2e-17 Identities = 40/53 (75%), Positives = 45/53 (84%) Frame = -1 Query: 330 MLSALISSAFSYRALPLA*QPEHQRYVHPGPLVLGTNPLNIPTPTADRDRTVS 172 M SA+I S +SY A+ LA Q HQRYVHPGPLVLGT+P+NIPTPTADRDRTVS Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRDRTVS 53