BLASTX nr result
ID: Rehmannia27_contig00043089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00043089 (439 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012839459.1| PREDICTED: uncharacterized protein LOC105959... 53 5e-06 >ref|XP_012839459.1| PREDICTED: uncharacterized protein LOC105959844 [Erythranthe guttata] Length = 166 Score = 53.1 bits (126), Expect = 5e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = +2 Query: 2 FFSWKDPPMCRRAKVIIPGLLKRINDMCKELEKME 106 +F+W DPPMC R++ IIPGLL+RIN+ KEL+K+E Sbjct: 104 YFAWVDPPMCERSRQIIPGLLRRINNNEKELKKIE 138