BLASTX nr result
ID: Rehmannia27_contig00041972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00041972 (363 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-li... 64 2e-09 ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan pr... 62 4e-09 ref|XP_012830881.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_015958926.1| PREDICTED: fasciclin-like arabinogalactan pr... 57 6e-08 ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 1e-07 ref|XP_015082454.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 1e-07 ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 1e-07 ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 1e-07 ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 2e-07 ref|XP_015935471.1| PREDICTED: fasciclin-like arabinogalactan pr... 57 2e-07 ref|XP_015935683.1| PREDICTED: fasciclin-like arabinogalactan pr... 57 2e-07 emb|CDP18905.1| unnamed protein product [Coffea canephora] 57 3e-07 gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partia... 57 4e-07 gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus g... 56 6e-07 gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata] 56 6e-07 gb|KNA19187.1| hypothetical protein SOVF_063720 [Spinacia oleracea] 56 6e-07 ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan pr... 56 6e-07 ref|XP_002534396.1| PREDICTED: fasciclin-like arabinogalactan pr... 56 8e-07 gb|KVI10601.1| FAS1 domain-containing protein [Cynara cardunculu... 55 1e-06 ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan pr... 55 2e-06 >ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan protein 2 [Sesamum indicum] Length = 390 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI+GTL+DEDPLAVYKIDKVLLPRELF Sbjct: 294 KVVTATIRGTLVDEDPLAVYKIDKVLLPRELF 325 >ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Sesamum indicum] Length = 409 Score = 62.4 bits (150), Expect = 4e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI+GTLIDEDPLAVYKIDKVLLP+ELF Sbjct: 307 KVVTATIEGTLIDEDPLAVYKIDKVLLPKELF 338 >ref|XP_012830881.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Erythranthe guttata] gi|604344000|gb|EYU42817.1| hypothetical protein MIMGU_mgv1a007557mg [Erythranthe guttata] Length = 403 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 K+VTA IKGTLI+EDPLAVYKIDKVLLP+ELF Sbjct: 301 KIVTAAIKGTLINEDPLAVYKIDKVLLPKELF 332 >ref|XP_015958926.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 161 Score = 57.4 bits (137), Expect = 6e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 K+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 41 KIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 72 >ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana sylvestris] Length = 407 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 301 KVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_015082454.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum pennellii] Length = 409 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 301 KVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum tuberosum] Length = 409 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 301 KVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum lycopersicum] Length = 409 Score = 58.2 bits (139), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 301 KVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana tomentosiformis] Length = 407 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTL DE+PL+VYKIDKVL+PRELF Sbjct: 301 KVVTATISGTLYDEEPLSVYKIDKVLMPRELF 332 >ref|XP_015935471.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 421 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 K+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 302 KIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333 >ref|XP_015935683.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 422 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 K+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 302 KIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333 >emb|CDP18905.1| unnamed protein product [Coffea canephora] Length = 412 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 358 VVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 VVTATI GT+IDEDP+AV+KIDKVLLPRELF Sbjct: 306 VVTATITGTVIDEDPVAVFKIDKVLLPRELF 336 >gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partial [Genlisea aurea] Length = 327 Score = 56.6 bits (135), Expect = 4e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GTLIDEDPLAV+KIDKVL P ELF Sbjct: 293 KVVTATITGTLIDEDPLAVFKIDKVLQPTELF 324 >gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus grandis] Length = 391 Score = 56.2 bits (134), Expect = 6e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GT+ID+DPL VYKIDKVL PRELF Sbjct: 305 KVVTATITGTVIDQDPLIVYKIDKVLQPRELF 336 >gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata] Length = 393 Score = 56.2 bits (134), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 358 VVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 +VTATI GTLID+DPLAVYKI+KVLLP+ELF Sbjct: 298 IVTATITGTLIDQDPLAVYKINKVLLPKELF 328 >gb|KNA19187.1| hypothetical protein SOVF_063720 [Spinacia oleracea] Length = 399 Score = 56.2 bits (134), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTA I GTL+D+DPLAV+K+DKVLLPRELF Sbjct: 297 KVVTAKITGTLVDKDPLAVFKLDKVLLPRELF 328 >ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Eucalyptus grandis] Length = 468 Score = 56.2 bits (134), Expect = 6e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GT+ID+DPL VYKIDKVL PRELF Sbjct: 366 KVVTATITGTVIDQDPLIVYKIDKVLQPRELF 397 >ref|XP_002534396.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Ricinus communis] gi|223525379|gb|EEF27989.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 55.8 bits (133), Expect = 8e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTATI GT+ DE+PL VYKIDKVLLPRELF Sbjct: 230 KVVTATITGTVKDEEPLVVYKIDKVLLPRELF 261 >gb|KVI10601.1| FAS1 domain-containing protein [Cynara cardunculus var. scolymus] Length = 399 Score = 55.5 bits (132), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTA + GT+IDE+P+A+YKIDKVLLPRELF Sbjct: 297 KVVTAAVTGTVIDEEPVALYKIDKVLLPRELF 328 >ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris subsp. vulgaris] gi|870850119|gb|KMT02265.1| hypothetical protein BVRB_9g206520 [Beta vulgaris subsp. vulgaris] Length = 402 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 361 KVVTATIKGTLIDEDPLAVYKIDKVLLPRELF 266 KVVTA I GTL+D+DP+A YK+DKVLLPRELF Sbjct: 298 KVVTAKITGTLVDKDPVAAYKLDKVLLPRELF 329