BLASTX nr result
ID: Rehmannia27_contig00041971
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00041971 (405 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan pr... 66 4e-10 ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-li... 65 8e-10 ref|XP_015958926.1| PREDICTED: fasciclin-like arabinogalactan pr... 59 2e-08 ref|XP_012830881.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_015082454.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 4e-08 ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan pr... 60 6e-08 ref|XP_015935471.1| PREDICTED: fasciclin-like arabinogalactan pr... 59 8e-08 ref|XP_015935683.1| PREDICTED: fasciclin-like arabinogalactan pr... 59 8e-08 emb|CDP18905.1| unnamed protein product [Coffea canephora] 59 1e-07 gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partia... 59 1e-07 gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus g... 58 2e-07 gb|KNA19187.1| hypothetical protein SOVF_063720 [Spinacia oleracea] 58 2e-07 ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 2e-07 ref|XP_002534396.1| PREDICTED: fasciclin-like arabinogalactan pr... 58 3e-07 gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata] 58 3e-07 gb|KVI10601.1| FAS1 domain-containing protein [Cynara cardunculu... 57 4e-07 ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan pr... 57 5e-07 >ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Sesamum indicum] Length = 409 Score = 65.9 bits (159), Expect = 4e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATIEGTLIDEDPLAVYKIDKVLLP+ELF Sbjct: 306 TKVVTATIEGTLIDEDPLAVYKIDKVLLPKELF 338 >ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan protein 2 [Sesamum indicum] Length = 390 Score = 65.1 bits (157), Expect = 8e-10 Identities = 41/82 (50%), Positives = 44/82 (53%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELFXXXXXXXXXXXXXXXXRDEXXXXXXXX 226 TKVVTATI GTL+DEDPLAVYKIDKVLLPRELF +DE Sbjct: 293 TKVVTATIRGTLVDEDPLAVYKIDKVLLPRELFKVAPSAPGTKSAKSRAQDE-ADAPGPA 351 Query: 225 XXXXXXXXXXSNDGERIFGGGG 160 SNDG R+ G GG Sbjct: 352 GDEVPADENSSNDGMRLVGCGG 373 >ref|XP_015958926.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 161 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TK+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 40 TKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 72 >ref|XP_012830881.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Erythranthe guttata] gi|604344000|gb|EYU42817.1| hypothetical protein MIMGU_mgv1a007557mg [Erythranthe guttata] Length = 403 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TK+VTA I+GTLI+EDPLAVYKIDKVLLP+ELF Sbjct: 300 TKIVTAAIKGTLINEDPLAVYKIDKVLLPKELF 332 >ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana sylvestris] Length = 407 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 300 TKVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_015082454.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum pennellii] Length = 409 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 300 TKVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum tuberosum] Length = 409 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 300 TKVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum lycopersicum] Length = 409 Score = 60.1 bits (144), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTL DE+PL+VYK+DKVLLPRELF Sbjct: 300 TKVVTATISGTLYDEEPLSVYKVDKVLLPRELF 332 >ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana tomentosiformis] Length = 407 Score = 59.7 bits (143), Expect = 6e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTL DE+PL+VYKIDKVL+PRELF Sbjct: 300 TKVVTATISGTLYDEEPLSVYKIDKVLMPRELF 332 >ref|XP_015935471.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 421 Score = 59.3 bits (142), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TK+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 301 TKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333 >ref|XP_015935683.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Arachis duranensis] Length = 422 Score = 59.3 bits (142), Expect = 8e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TK+VTA I GTLIDEDPLA+Y IDKVLLPRELF Sbjct: 301 TKIVTAKITGTLIDEDPLAIYTIDKVLLPRELF 333 >emb|CDP18905.1| unnamed protein product [Coffea canephora] Length = 412 Score = 58.9 bits (141), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 T VVTATI GT+IDEDP+AV+KIDKVLLPRELF Sbjct: 304 TNVVTATITGTVIDEDPVAVFKIDKVLLPRELF 336 >gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partial [Genlisea aurea] Length = 327 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GTLIDEDPLAV+KIDKVL P ELF Sbjct: 292 TKVVTATITGTLIDEDPLAVFKIDKVLQPTELF 324 >gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus grandis] Length = 391 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GT+ID+DPL VYKIDKVL PRELF Sbjct: 304 TKVVTATITGTVIDQDPLIVYKIDKVLQPRELF 336 >gb|KNA19187.1| hypothetical protein SOVF_063720 [Spinacia oleracea] Length = 399 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTA I GTL+D+DPLAV+K+DKVLLPRELF Sbjct: 296 TKVVTAKITGTLVDKDPLAVFKLDKVLLPRELF 328 >ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Eucalyptus grandis] Length = 468 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GT+ID+DPL VYKIDKVL PRELF Sbjct: 365 TKVVTATITGTVIDQDPLIVYKIDKVLQPRELF 397 >ref|XP_002534396.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Ricinus communis] gi|223525379|gb|EEF27989.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 57.8 bits (138), Expect = 3e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTATI GT+ DE+PL VYKIDKVLLPRELF Sbjct: 229 TKVVTATITGTVKDEEPLVVYKIDKVLLPRELF 261 >gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata] Length = 393 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 T +VTATI GTLID+DPLAVYKI+KVLLP+ELF Sbjct: 296 TTIVTATITGTLIDQDPLAVYKINKVLLPKELF 328 >gb|KVI10601.1| FAS1 domain-containing protein [Cynara cardunculus var. scolymus] Length = 399 Score = 57.4 bits (137), Expect = 4e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTA + GT+IDE+P+A+YKIDKVLLPRELF Sbjct: 296 TKVVTAAVTGTVIDEEPVALYKIDKVLLPRELF 328 >ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris subsp. vulgaris] gi|870850119|gb|KMT02265.1| hypothetical protein BVRB_9g206520 [Beta vulgaris subsp. vulgaris] Length = 402 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 405 TKVVTATIEGTLIDEDPLAVYKIDKVLLPRELF 307 TKVVTA I GTL+D+DP+A YK+DKVLLPRELF Sbjct: 297 TKVVTAKITGTLVDKDPVAAYKLDKVLLPRELF 329