BLASTX nr result
ID: Rehmannia27_contig00041390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00041390 (1959 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF27313.1| conserved hypothetical protein, partial [Ricinus ... 109 2e-31 >gb|EEF27313.1| conserved hypothetical protein, partial [Ricinus communis] Length = 141 Score = 109 bits (272), Expect(2) = 2e-31 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = +2 Query: 356 VRELVRGNLSVFTNFISSFSLTGLTPPLSPIEVRLAYSETVLGTCLPFFPIDKELRNECL 535 VRELVRGNLS FTNFISSFSL GLT PL PIEVRLAYSETVLGTCLPFFP+DK+LR+ECL Sbjct: 82 VRELVRGNLSAFTNFISSFSLPGLTRPLYPIEVRLAYSETVLGTCLPFFPLDKQLRSECL 141 Score = 57.4 bits (137), Expect(2) = 2e-31 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 247 ASKKGSVRGLCQEPSSLEQHSIVHLDKEVPH 339 ASK+GSV GLC+EPSSLEQH VHLDKEVPH Sbjct: 48 ASKRGSVPGLCEEPSSLEQHCKVHLDKEVPH 78